Phishing : infodamart@n.damart.fr L'Equipe des comptes Microsoft

SUSPECTED SCAM!

Date05/23/2020
Fraudulent emailinfodamart@n.damart.fr
PseudonymL'Equipe des comptes Microsoft
Url / Websitehttps://account.live.com/dp?ft=Da2ixHCzPdIV4hMwQ7jocAkBG30Gn4oFQboyzcgB38aTxdEHCO97XMPCf2Qg1TEk5usZ8xZUWNZKj4S07xpBIRewNcq3oiqkfUWfirwbC3qy5dkBu!kxX5GMKJUIp0FrM!0QrPyr6z3UTdeDX!SuG1FLQ0BcGMWh4T4re0K0fJ8hY37vD9XNtu30kqRG8oej3H1cbzoVdkMOs0tqWUVrbR9NOiH
Scam contentsDe : Support [mailto:infodamart@n.damart.fr]
c3b9d716ad426227687262e75d73df3e@mwinf5c12.me-wanadoo.net
Envoyé : vendredi 22 mai 2020 11:54
À : prenom.nom@orange.fr
Objet : Prime

Compte Microsoft

Code de r?initialisation de mot de passe

Utilisez ce code pour r?initialiser le mot de passe du compte Microsoft ro*****@orange.fr.

Voici votre code : 5549976

Si vous ne reconnaissez pas le compte Microsoft ro*****@orange.fr, vous pouvez cliquer ici pour supprimer votre adresse e-mail de ce compte.

Merci,

L??quipe des comptes Microsoft

Orange store

IPHONE 11
SAMSUNG GALAXY S10
ORANGE TM Offres Mobiles, Internet, TV, Actu & Accès…

Cher client,

Je suis Emma Jade, Responsable service client d’Orange.

Merci d’être fidèle à votre opérateur téléphonique orange. Vous êtes l’un de nos clients exceptionnels à gagner un smartphone, je vous laisse ce lien pour obtenir votre cadeau et on vous contactera dans les prochaines 48h.

Commencez dès maintenant

Anny Aricie
Responsable service client

Retrouvez Orange sur Facebook | twitter | GooglePlus | LinkedIn

La partie cachée en basculant dans le courrier comme indésirable :

Compte Microsoft

Code de r?initialisation de mot de passe

Utilisez ce code pour r?initialiser le mot de passe du compte Microsoft ro*****@orange.fr.

Voici votre code : 5549976

Si vous ne reconnaissez pas le compte Microsoft ro*****@orange.fr, vous pouvez cliquer ici
https://account.live.com/dp?ft=Da2ixHCzPdIV4hMwQ7jocAkBG30Gn4oFQboyzcgB38aTxdEHCO97XMPCf2Qg1TEk5usZ8xZUWNZKj4S07xpBIRewNcq3oiqkfUWfirwbC3qy5dkBu!kxX5GMKJUIp0FrM!0QrPyr6z3UTdeDX!SuG1FLQ0BcGMWh4T4re0K0fJ8hY37vD9XNtu30kqRG8oej3H1cbzoVdkMOs0tqWUVrbR9NOiHBJbAuf6xqxw1kZi!reB8R3e1OjTjQvKA4wtF!a58TSPeT43Rh0KREmwryiAxhKOJx0biokUHEa0cQgsSM4i6ZVzADdfVNhk9dh1jo!A%24%24 pour supprimer votre adresse e-mail de ce compte.

Merci,

L??quipe des comptes Microsoft
Voir sur le navigateur https://t.ly/0wZM?0POKJB29QGTXUUT

live.com

Domain Information

Domain: live.com
Registrar: CSC Corporate Domains, Inc.
Registered On: 1994-12-28
Expires On: 2020-12-27
Updated On: 2019-12-23
Status: clientDeleteProhibited | clientTransferProhibited | clientUpdateProhibited | serverDeleteProhibited | serverTransferProhibited | serverUpdateProhibited
Name Servers: ns1.msft.net | ns2.msft.net | ns3.msft.net | ns4.msft.net | nse12.o365filtering.com | nse13.o365filtering.com | nse21.o365filtering.com | nse24.o365filtering.com

Registrant / Administrative Contacts

Name: Domain Administrator
Organization:

Microsoft Corporation
Redmond, WA 98052 USA
Phone: +1 425 882 8080
Fax: +1 425 936 7329
Email: domains@microsoft.com

Technical Contact

Email: msnhst@microsoft.com

Raw Whois Data
Domain Name: live.com
Registry Domain ID: 2344732_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.corporatedomains.com
Registrar URL: https://www.cscdbs.com
Updated Date: 2019-12-23T01:15:20Z
Creation Date: 1994-12-28T00:00:00Z
Registrar Registration Expiration Date: 2020-12-27T05:00:00Z
Registrar: CSC CORPORATE DOMAINS, INC.
Sponsoring Registrar IANA ID: 299
Registrar Abuse Contact Email: domainabuse@cscglobal.com
Registrar Abuse Contact Phone: +1 888 780 2723

-------------------------------------------------------------------

Récompenses Exclusives ★

Orange
Client Enquête
Survey by goldenresearch

Félicitations Cher Client Orange!

Votre adresse IP XX.XXX.XX.XX4 a été sélectionné pour recevoir GRATUITEMENT un Samsung Galaxy S20 ou un Apple iPhone 11.

Pour recevoir votre cadeau, il vous suffit de répondre à notre sondage anonyme. Mais dépêchez-vous! Il ne reste qu'un nombre limité de cadeaux pour aujourd'hui!

Disponible pour aujourd'hui uniquement: 23 Mai 2020

Commencer

Deniel Couture
Je viens d’appeler le transporteur. Il m’a dit qu’il m’apporterait le colis aujourd’hui. Mais quand même, j’attends d’avoir l’iPhone entre les mains pour y croire vraiment :)
Mai 23, 2020 at 12:01 am

Léa Lefebvre
Le sondage était rapide et facile. Ça me dérangerait pas de répondre à un autre pour recevoir un autre cadeau gratuit.
Mai 22, 2020 at 2:24 pm

Marie Rousseau
J'ai réceptionné le mien aujourd'hui! Merci beaucoup pour ce nouvel iPhone 7!
Mai 20, 2020 at 11:55 am

Emma Thomas
Je pensais que c’était une arnaque, mais je viens vraiment de recevoir un iPhone ce matin. Un original, sans aucune escroquerie. J’ai répondu au questionnaire avec le nom de ma copine et de ma mère, des fois que ça marche encore une fois, hahaha
Mai 20, 2020 at 8:47 am

Alexandre Bourgeois
Merci pour les cadeaux ! J'ai donné la crème pour la peau à ma sœur pour son anniversaire . Je me suis inscrit pour tous les éléments énumérés ! Pourquoi pas?
Mai 18, 2020 at 6:16 pm

Guillaume Dubois
J’ai reçu aujourd’hui mon nouveau Samsung. Jusque-là, je pensais que c’était une blague, mais j’avais tort. Merci infiniment aux organisateurs pour ce cadeau !
Mai 17, 2020 at 4:16 pm

Lucas Roux
J'ai choisi le samsung s10 pour ma mère. C'était un cadeau parfait et elle est tellement heureuse!
Mai 16, 2020 at 6:48 pm

Lillian Ong
Je pensais que ce était une blague au début, par mon samsung galaxy S8 effectivement venu dans le courrier ce matin et il n'y a rien qui me empêche de se inscrire à chacun d'eux, que je ai fait hehe
Mai 15, 2020 at 17:07

Politique de confidentialité

Votre vie privée est importante pour nous. Nous ne recueillons pas vos informations personnelles dans ce questionnaire. S'il vous plaît consulter notre politique et modalités confidentialité. Nous ne sommes pas affiliés ni un partenariat avec une tierce partie. Voir les termes et conditions importants.

https://t.ly/0wZM?0POKJB29QGTXUUT qui vous redirige automatiquement à ce site de sondage d'enquête supposée d'Orange à leur insu avec des faux témoignages des clients factices.

https://winbinkly.com/fr-20-1-3/?df07727947ab994df30b0cf30ad1704f

winbinkly.com

Domain Information
Domain: winbinkly.com
Registrar: Name.com, Inc.
Registered On: 2020-02-13
Expires On: 2021-02-13
Updated On: 2020-04-15
Status: clientTransferProhibited
Name Servers: aurora.ns.cloudflare.com | dan.ns.cloudflare.com

Registrant / Administrative / Technical Contacts

Name: Whois Agent
Organization:

Domain Protection Services, Inc.
PO Box 1769
Denver, CO 80201 USA
Phone: +1 720 800 9072
Fax: +1 720 975 8725
Email:
https://www.name.com/contact-domain-whois/winbinkly.com

Raw Whois Data
Domain Name: WINBINKLY.COM
Registry Domain ID: 2492339123_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.name.com
Registrar URL: https://www.name.com
Updated Date: 2020-04-15T23:39:02Z
Creation Date: 2020-02-13T23:12:24Z
Registrar Registration Expiration Date: 2021-02-13T23:12:24Z
Registrar: Name.com, Inc.
Registrar IANA ID: 625
Registrar Abuse Contact Email: abuse@name.com
Registrar Abuse Contact Phone: +1 720 310 1849

Golden Research
Cabinet de conseil
P.O.Box 220132
Riyadh 11311, Saudi Arabia.
Tel: 01-4823166
Fax: 01- 4806353
Mobile: 0531844440
Email: gr@goldenresearch.com.sa
Website: http://goldenresearch.com.sa

----------------------------------------------------

En-têtes Internet / Source du message :

Return-Path: infodamart@n.damart.fr

https://www.damart.fr/
domain: damart.fr
status: ACTIVE
hold: NO
holder-c: D28410-FRNIC
admin-c: D25422-FRNIC
tech-c: HM1896-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL52765-FRNIC
registrar: SAFEBRANDS
Expiry Date: 2020-08-08T11:10:21Z
created: 2004-02-19T23:00:00Z
last-update: 2019-06-23T03:37:24Z
source: FRNIC

ns-list: NSL52765-FRNIC
nserver: a.ns.mailclub.fr
nserver: b.ns.mailclub.eu
nserver: c.ns.mailclub.com
source: FRNIC

registrar: SAFEBRANDS
type: Isp Option 1

SafeBrands Méditerranée
Pôle Media de la Belle de Mai
37-41, rue Guibal
13003 MARSEILLE, France
Emails: fg@safebrands.com
Website: https://selling.safebrands.com

Veuillez utiliser ce formulaire pour signaler à SafeBrands un nom de domaine qui, selon votre analyse, présente un caractère illicite.

https://safebrands.fr/signalement-dun-domaine-presume-illicite/

Conformément à la loi, le contenu illicite est soumis à interprétation selon les législations. Toutefois, on peut citer les cas suivants universellement reconnus :

• les sites de Phishing
• un contenu raciste ou discriminatoire
• la cybercriminalité : fraude, piratage, vol d’identité
• la production et la distribution de contenus mettant en scène des sévices sexuels sur des enfants

Si vous êtes face à un contenu de ce type, merci de saisir le formulaire suivant :
https://safebrands.fr/signalement-dun-contenu-presume-illicite/

anonymous: NO
registered: 1999-01-01T12:00:00Z
source: FRNIC

nic-hdl: D28410-FRNIC
type: ORGANIZATION
contact: DAMART

Chaîne de vêtements et sous-vêtements (adultes et enfants) en textile innovant, anti-froid et humidité.

Damart-ServiPoste SAS
25 avenue de la Fosse-aux-Chênes
59100 ROUBAIX, France
Tél : 03 20 11 46 86 | 03 20 11 45 00
Email : infoweb@damart.com
Site web : https://www.damart.fr

registrar: SAFEBRANDS
changed: 2018-02-14T15:03:25Z nic@nic.fr
anonymous: NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: D25422-FRNIC
type: ORGANIZATION
contact: D.S.B.

D.S.B.
160 boulevard de Fourmies
59100 ROUBAIX, France
Tél : 03 20 11 46 86
Email : infoweb@damart.com
Site web : https://www.damart.fr

registrar: SAFEBRANDS
changed: 2017-10-06T07:50:58Z nic@nic.fr
anonymous: NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: HM1896-FRNIC
type: PERSON
contact: Host Master

SafeBrands Méditerranée
Pôle Media de la Belle de Mai
37-41, rue Guibal
13003 MARSEILLE, France
Tél : 04 88 66 22 22
Fax : 04 88 66 22 20
Emails : clientele@safebrands.com | fg@safebrands.com
Website : https://selling.safebrands.com

Veuillez utiliser ce formulaire pour signaler à SafeBrands un nom de domaine qui, selon votre analyse, présente un caractère illicite.

https://safebrands.fr/signalement-dun-domaine-presume-illicite/

Conformément à la loi, le contenu illicite est soumis à interprétation selon les législations. Toutefois, on peut citer les cas suivants universellement reconnus :

• les sites de Phishing
• un contenu raciste ou discriminatoire
• la cybercriminalité : fraude, piratage, vol d’identité
• la production et la distribution de contenus mettant en scène des sévices sexuels sur des enfants

Si vous êtes face à un contenu de ce type, merci de saisir le formulaire suivant :
https://safebrands.fr/signalement-dun-contenu-presume-illicite/

registrar: SAFEBRANDS
changed: 2016-08-23T09:21:56Z nic@nic.fr
anonymous: NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

Received: from mwinf5c12 (mwinf5c12 [10.223.111.62])

Whois IP 10.223.111.62

NetRange: 10.0.0.0 - 10.255.255.255
CIDR: 10.0.0.0/8
NetName: PRIVATE-ADDRESS-ABLK-RFC1918-IANA-RESERVED
NetHandle: NET-10-0-0-0-1
Parent: ()
NetType: IANA Special Use
OriginAS:
Organization: Internet Assigned Numbers Authority (IANA)
RegDate:
Updated: 2013-08-30

A propos de cette adresse IP address : 10.223.111.62 qui confirme l’origine de sa provenance via une société américaine privée Internet Assigned Numbers Authority qui supervise l'allocation globale des adresses IP très prisée par les escrocs, les fraudeurs, les arnaqueurs, les scamme(u)rs, les harke(u)rs, les brouteurs, les spamme(u)rs, etc… pour « leur business / activité malveillant(e) » qui ne veulent pas laisser de traçabilité de géolocalisation de leur propre adresse IP privée histoire de brouiller leur domiciliation légitime.

These addresses are in use by many millions of independently operated networks, which might be as small as a single computer connected to a home gateway, and are automatically configured in hundreds of millions of devices. They are only intended for use within a private context and traffic that needs to cross the Internet will need to use a different, unique address.

These addresses can be used by anyone without any need to coordinate with IANA or an Internet registry. The traffic from these addresses does not come from ICANN or IANA. We are not the source of activity you may see on logs or in e-mail records. Please refer to https://www.iana.org/help/abuse-answers

These addresses were assigned by the IETF, the organization that develops Internet protocols, in the Best Current Practice document, RFC 1918 which can be found at: https://datatracker.ietf.org/doc/rfc1918/
Email : datatracker-project@ietf.org

Ref: https://rdap.arin.net/registry/ip/10.0.0.0

Registre de domaine de premier niveau

L'Internet Assigned Numbers Authority est un département de l'ICANN, une société américaine privée à but non lucratif qui supervise l'allocation globale des adresses IP, l'allocation des numéros de systèmes autonomes, la gestion de la zone racine dans les Domain Name System (DNS).

OrgName: Internet Assigned Numbers Authority
OrgId: IANA

Internet Assigned Numbers Authority (IANA)
12025 Waterfront Drive, Suite 300
Los Angeles, CA 90292 USA
Phone: +1 424 254 5300
Fax: +1 424 254 5033
Email: iana@iana.org
Website: https://www.iana.org/

Si vous avez des questions concernant les abus, veuillez consulter notre page Abus Issues and IP Address https://www.iana.org/abuse

Certaines des choses les plus courantes que nous entendons sont "Mon réseau est attaqué par l'IANA!" et "IANA me spamme" Si vous pensez que c'est le cas, veuillez prendre quelques instants pour lire cette page.

L'Internet Assigned Numbers Authority, ou IANA, est responsable de la coordination globale des adresses IP. La plupart des numéros utilisés sont attribués via un système d'attribution régional à votre FAI, qui vous en attribue ensuite automatiquement un ou plusieurs.

Il existe cependant des ensembles spéciaux de numéros conçus pour ne pas être attribués à une personne en particulier. Au lieu de cela, ce sont des allocations générales qui sont soit utilisées de manière spéciale, soit conçues pour que les gens les utilisent en interne dans les réseaux locaux.

Ces chiffres se situent principalement dans les plages suivantes:

Commence par 10. (c.-à-d. 10.0.0.0 à 10.255.255.255)
Commence par 127.
Commence par 169.254.
Commence par 172.16. à 172.31.
Commence par 192.168.

Apparaît dans vos journaux avec un nom comme blackhole-1.iana.org

Il existe d'autres plages de numéros qui sont également marquées comme «IANA réservée» et ne sont pas non plus exploitées par l'IANA, bien que ce soient les plus courantes pour lesquelles nous recevons des rapports d'abus.

Si vous voyez du trafic Internet inexpliqué vers votre ordinateur à partir de ces numéros, il est important de se rappeler les choses suivantes:

Le trafic ne provient pas de l'IANA. En tant qu'autorité pour les adresses IP, nous avons simplement réservé ces numéros dans nos bases de données, mais nous ne les utilisons ni ne les exploitons, et nous ne sommes pas la source du trafic.

Étant donné que l'utilisation de ces numéros n'est ni suivie ni restreinte, nous ne pouvons pas vous dire qui utilise ces numéros.

Il est parfaitement normal de voir le trafic provenant de ces numéros si vous avez un petit réseau domestique ou professionnel. Par défaut, la plupart des routeurs et points d'accès utilisent ces numéros pour attribuer à vos ordinateurs locaux. Il est fort probable que ces chiffres représentent des ordinateurs sur votre propre réseau interne.

Si vous voyez ces chiffres dans les en-têtes d'un e-mail non sollicité, ils indiquent généralement le transit entre les serveurs d'un réseau d'entreprise ou d'un FAI. Ils ne sont pas utiles pour identifier l'origine d'un e-mail. Dans de tels cas, vous pouvez généralement trouver la véritable origine en recherchant le premier en-tête de courrier «reçu» qui n'est pas une adresse réservée par l'IANA.

A propos d’Internet Assigned Numbers Authority, association à but non lucratif

L'Internet Assigned Numbers Authority est un département de l'ICANN, une société américaine privée à but non lucratif qui supervise l'allocation globale des adresses IP, l'allocation des numéros de systèmes autonomes, la gestion de la zone racine dans les Domain Name System

RegDate:
Updated: 2012-08-31
Ref: https://rdap.arin.net/registry/entity/IANA

OrgAbuseHandle: IANA-IP-ARIN
OrgAbuseName: ICANN
OrgAbusePhone: +1 310 301 5820
OrgAbuseEmail: abuse@iana.org
OrgAbuseRef: https://rdap.arin.net/registry/entity/IANA-IP-ARIN

by mwinb2z06 with LMTPA;
Fri, 22 May 2020 14:14:37 +0200
X-Sieve: CMU Sieve 2.3
Received: from premium.orange.fr ([85.90.246.92])

Whois IP 85.90.246.92

Information related to 85.90.244.0 - 85.90.247.255

Abuse contact for 85.90.244.0 - 85.90.247.255 is abuse@linode.com

inetnum: 85.90.244.0 - 85.90.247.255
netname: US-LINODE-20041112
country: DE(UTSCHLAND) | ALLEMAGNE
org: ORG-LL72-RIPE
admin-c: TA2589-RIPE
tech-c: TA2589-RIPE
status: ALLOCATED PA

Veuillez envoyer les rapports d'abus à : abuse@linode.com
Ce bloc est utilisé pour les allocations clients statiques

Please send abuse reports to abuse@linode.com
This block is used for static customer allocations

mnt-by: RIPE-NCC-HM-MNT
mnt-by: linode-mnt
mnt-lower: Linode-mnt
mnt-domains: Linode-mnt
mnt-routes: Linode-mnt
created: 2015-03-31T15:02:46Z
last-modified: 2018-06-19T08:19:49Z
source: RIPE # Filtered

organisation: ORG-LL72-RIPE
org-name: Linode, LLC
org-type: LIR

Au sujet de…

Linode, LLC est une société d'hébergement cloud privée américaine qui fournit des serveurs privés virtuels. Il est basé à Philadelphie, en Pennsylvanie.

Administrative Offices

Linode, LLC
249 Arch Street
Philadelphia, PA 19106, USA
Phone: +1 609 380 7100 | +1 855 454 6633
Fax: +1 609 380 7200
Email: service@linode.com
Website: https://www.linode.com

admin-c: AF11785-RIPE
admin-c: TA2589-RIPE
tech-c: AF11785-RIPE
abuse-c: LAS85-RIPE
mnt-ref: RIPE-NCC-HM-MNT
mnt-ref: linode-mnt
mnt-by: RIPE-NCC-HM-MNT
mnt-by: linode-mnt
created: 2009-11-02T13:42:45Z
last-modified: 2018-06-19T01:10:36Z
source: RIPE # Filtered

SWAT raids Linode offices as founder’s server is attacked
Linode has been a victim of a SWATting prank, with its office searched for signs of explosives.

Internet Publishing and Broadcasting and Web Search Portals

person(ne): Thomas Asaro, Chief Operations Officer
https://www.facebook.com/tom.asaro

Linode, LLC
329 E. Jimmie Leeds Road, Suite A,
Galloway, NJ 08205-4110 USA
Phone: +1 609 380 7504 | +1 609 380 7100
Fax: +1 609 380 7200
Emails: tasaro@linode.com | service@linode.com | privacy@linode.com
Website: https://www.linode.com

nic-hdl: TA2589-RIPE
mnt-by: Linode-mnt
created: 2009-11-02T17:17:56Z
last-modified: 2014-11-20T18:51:15Z
source: RIPE

by mwinf5c12 with ME
id hoEc2200k20LbnZ01oEc5d; Fri, 22 May 2020 14:14:36 +0200
X-bcc: prenom.nom@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (-308)(0000)gggruggvucftvghtrhhoucdtuddrgeduhedruddufedggeekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrihhlohhuthemucegtddtnecundfqrhgrnhhgvgeurggutfgvphhuthfkphculddqfedtkedmnecujfgurhepfffhvffugggtgfesrgejtdertddtjeenucfhrhhomhepfdfuuhhpphhorhhtfdcuoehinhhfohgurghmrghrthesnhdruggrmhgrrhhtrdhfrheqnecuggftrfgrthhtvghrnhepiedvudeuffekfeejgfevhfehueeguefffedvudeutddtleeikedvgfduvedvgfdunecuffhomhgrihhnpehlihhvvgdrtghomhdpthdrlhihnecukfhppeekhedrledtrddvgeeirdelvdenuceurggutfgvphhuthfgmhgrihhlpehrohdnnddnnddnsehorhgrnhhgvgdrfhhrnecuvehluhhsthgvrhfuihiivgepudefvdenucfrrghrrghmpehhvghlohepphhrvghmihhumhdrohhrrghnghgvrdhfrhdpihhnvghtpeekhedrledtrddvgeeirdelvddpmhgrihhlfhhrohhmpehinhhfohgurghmrghrthesnhdruggrmhgrrhhtrdhfrhdprhgtphhtthhopehphhhilhhiphhpvgdrtghoqhhuvghtieekjeesohhrrghnghgvrdhfrh
X-me-spamlevel: not-spam
X-ME-Helo: premium.orange.fr
domain: orange.fr
status: ACTIVE
hold: NO
holder-c: O7771-FRNIC
admin-c: BLF95-FRNIC
tech-c: SNDD100-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL52444-FRNIC
registrar: ORANGE
Expiry Date: 2020-10-14T15:12:55Z
created: 2001-02-01T23:00:00Z
last-update: 2020-02-14T10:33:11Z
source: FRNIC

ns-list: NSL52444-FRNIC
nserver: ns1.orange.fr [80.10.201.224 2a01:cb04:2040:2::1]
nserver: ns2.orange.fr [80.10.202.224 2a01:cb14:2040::1]
source: FRNIC

registrar: ORANGE
type: Isp Option 1

ORANGE
78-84, rue Olivier de Serres
75015 PARIS CEDEX 15, France
Tél : 08 25 02 87 87
Email : fournisseurs.relations@orange.com
website : https://cloud.orange-business.com/offres/infrastructure-iaas/nom-de-domaine/

anonymous: NO
registered: 2006-02-15T12:00:00Z
source: FRNIC

nic-hdl: O7771-FRNIC
type: ORGANIZATION
contact: ORANGE

ORANGE
78-84, rue Olivier de Serres
75015 PARIS, France
Tél: 01 44 44 22 22
Fax : 01 45 30 52 71
Email: gestionndd@francetelecom.biz

registrar: ORANGE
changed: 2018-02-21T08:11:58Z nic@nic.fr
anonymous: NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: BLF95-FRNIC
type: PERSON(NE)
contact: Beatrice Leopold-Fenu

ORANGE
78-84 rue Olivier de Serres
75015 PARIS, France
Tél: 01 44 44 08 50
Fax: 01 45 30 52 71
Email: gestionndd@francetelecom.biz

registrar: ORANGE
changed: 2017-08-24T09:37:03Z nic@nic.fr
anonymous: NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: SNDD100-FRNIC
type: PERSON
contact: Service Nom De Domaine

Orange business services - obs
13, rue de javel
75015 PARIS, France
Tél : 01 53 95 14 00
Fax : 01 53 95 14 01
Email : domaine.admin@orange.com

registrar: ORANGE
changed: 2016-09-12T14:40:01Z nic@nic.fr
anonymous: NO
obsoleted: NO
eligstatus: ok
eligdate: 2016-09-12T14:40:01Z
reachstatus: not identified
source: FRNIC

X-ME-IP: 85.90.246.92
X-ME-Entity: ofr
Message-ID: c3b9d716ad426227687262e75d73df3e@mwinf5c12.me-wanadoo.net

me-wanadoo.net

Domain Information

Domain: me-wanadoo.net
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registered On: 2015-06-23
Expires On: 2020-06-23
Updated On: 2019-06-14
Status: clientTransferProhibited
Name Servers: ns1.mytrafficmanagement.com | ns2.mytrafficmanagement.com

Registrant / Administrative / Technical Contacts

Name: Domain Admin
Organization:

Privacy Protect, LLC (PrivacyProtect.org)
10 Corporate Drive
Burlington, MA 01803 USA
Phone: +1 802 227 4003
Email: contact@privacyprotect.org
Website: http://privacyprotect.org

Raw Whois Data
Domain Name: ME-WANADOO.NET
Registry Domain ID: 1941302846_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: https://publicdomainregistry.com
Updated Date: 2019-08-14T02:18:44Z
Creation Date: 2015-06-23T13:29:14Z
Registrar Registration Expiration Date: 2020-06-23T13:29:14Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1 201 377 5952

Date: Fri, 22 May 2020 11:54:17 +0200
From:"Support" infodamart@n.damart.fr
To: prenom.nom@orange.fr
Subject:Prime
MIME-Version: 1.0
Content-Type: multipart/alternative;boundary="-==BAUROUTER11877284=="
Content-Transfer-Encoding: 7bit

Received and posted by Fraud Watcher/Advisor
Your comments / analysisJe reçois cet email au nom de Microsoft et d’Orange Store avec ma propre adresse email légitime.

Pour Microsoft qui me fournit un code à taper pour soi-disant réinitialiser un mot de passe sur le compte de Microsoft avec une adresse email qui n’est pas la mienne de surcroît : « ro*****@orange.fr Voici votre code : 5549976 ».

Même « Si vous ne reconnaissez pas le compte Microsoft ro*****@orange.fr, vous pouvez cliquer ici pour supprimer votre adresse e-mail de ce compte. https://account.live.com/dp?ft=Da2ixHCzPdIV4hMwQ7jocAkBG30Gn4oFQboyzcgB38aTxdEHCO97XMPCf2Qg1TEk5usZ8xZUWNZKj4S07xpBIRewNcq3oiqkfUWfirwbC3qy5dkBu!kxX5GMKJUIp0FrM!0QrPyr6z3UTdeDX!SuG1FLQ0BcGMWh4T4re0K0fJ8hY37vD9XNtu30kqRG8oej3H1cbzoVdkMOs0tqWUVrbR9NOiHBJbAuf6xqxw1kZi!reB8R3e1OjTjQvKA4wtF!a58TSPeT43Rh0KREmwryiAxhKOJx0biokUHEa0cQgsSM4i6ZVzADdfVNhk9dh1jo!A%24%24 alors que je n’ai pas de compte chez « live.com » sans aucun rapport avec l’adresse email dont il fait allusion : « ro*****@orange.fr » et encore moins la mienne qui comme par un « p » p*****@orange.fr ».

Ne pas cliquer ce lien URL frauduleux parmi tant d'autres
https://account.live.com/dp?ft=Da2ixHCzPdIV4hMwQ7jocAkBG30Gn4oFQboyzcgB38aTxdEHCO97XMPCf2Qg1TEk5usZ8xZUWNZKj4S07xpBIRewNcq3oiqkfUWfirwbC3qy5dkBu!kxX5GMKJUIp0FrM!0QrPyr6z3UTdeDX!SuG1FLQ0BcGMWh4T4re0K0fJ8hY37vD9XNtu30kqRG8oej3H1cbzoVdkMOs0tqWUVrbR9NOiH qui vous dirige automatiquement vers un compte utilisateur associé à votre messagerie @live.com en usurpant votre identité et vos (coor)données confidientielles, à savoir votre identifiant, mot de passe en se faisant passer pour vous " à votre place " auprès de fournisseur d'accès internet et inversement à leur insu pour accéder directement à votre compte email sans que vous le sachiez comme une signature manifeste d'une tentative d'intrusion de phishing.

Pour Orange, j’ai 2 personnes qui se présentent

« Je suis Emma Jade, Responsable service client d’Orange »

(…)

puis une autre :

« Anny Aricie
Responsable service client »

au lieu d’une seule interlocutrice suffit vu qu’elles ont les mêmes fonctions : « Responsable service client »

Il s'agit d'une fausse campagne d'enquête de sondage auprès des utilisateurs/clients fidèles à la marque en se faisant passer pour votre opérateur d'Orange et à leur insu pour répondre à un questionnaire en vue d'obtenir vos (coor)données bancaires et vous souscrire à un abonnement mensuel dit caché sans votre consentement après une période d'essai gratuit limitée et sans réponse de résiliation de votre part, vous acceptez les CGV du site en question.

Signature classique d'un phishing

X-me-spamlevel: not-spam ce qui explique qu'aucun éditeur de logiciel quelconque n'est capable de signaler cet email comme spam ou courrier indésirable pour passer entre les mailles du filet comme une passoire sans qu'il soit filtré sérieusement par des soi-disant professionnels de la sécurité numérique.
Attachment(s)
More info +What to do in case of scam ?
Warn your friends!
Your comment will be added
just after your validation
Francais Anglais Italien Allemand Espagnol