Arnaque via PayPal : PayPal Votre compte a été limité


Pseudonyme utiliséPayPal Votre compte a été limité
Url / Site internet
Contenu de l'arnaqueDe : Info []
Envoyé : mercredi 24 avril 2019 16:24
À :
Objet : Votre compte a été limité

Logo usurpé de PayPal à leur insu


Cher(e) client(e),
Vous devez confirmer votre compte PayPaI
Nous avons limiter votre compte en raison d'une connexion inhabituelle. Cliquez sur le bouton "Se connecter" ci dessous pour confirmer vos informations.
Se connecter qui vous redirige vers un faux site sécurisé imitant la page web d’accueil de PayPal à leur insu dans le seul but de vous voler vos informations confidentielles, à savoir votre identifiant, adresse email personnelle, mode de passe et de vos coordonnées bancaires en se faisant passer pour vous à votre place auprès de PayPal.

? 2019

Ce site web a été signalé comme n’étant pas sécurisé. Hébergé par

Nous vous recommandons de quitter ce site web. Il a été signalé à Microsoft comme constituant une menace pour votre PC et pouvant mettre en danger vos informations personnelles ou financières.

En-têtes Internet / source de message :


Domain name: S-VERIF.TK


Dot TK administrator
P.O. Box 11774
1001 GT Amsterdam
Netherlands (Pays-Bas)
Phone: +31 20 5315725
Fax: +31 20 5315721
E-mail: abuse:, copyright infringement:


Your selected domain name is a Free Domain. That means that, according to the terms and conditions of Free Domain domain names the registrant is BV Dot TK

Due to restrictions in Dot TK 's Privacy Statement personal information about the user of the domain name cannot be released.


If you want to report abuse of this domain name, please send a detailed email with your complaint to In most cases Dot TK responds to abuse complaints within one business day.


If you want to report a case of copyright infringement, please send an email to, and include the full name and address of your organization. Within 5 business days copyright infringement notices will be investigated.

Record maintained by: Dot TK Domain Registry
Received: from mwinf5c62 (mwinf5c62 [])

Whois IP

OrgAbuseHandle: IANA-IP-ARIN
OrgAbuseName: ICANN
OrgAbusePhone: +1-310-301-5820

by mwinb2z06 with LMTPA;
Wed, 24 Apr 2019 16:23:47 +0200
X-Sieve: CMU Sieve 2.3
Received: from ([])

Whois IP

Information related to -

Abuse contact for - is

inetnum: -
netname: OVH
descr: OVH SAS
descr: dedicated servers
country: FR
admin-c: OK217-RIPE
tech-c: OTC2-RIPE
mnt-by: OVH-MNT
created: 2011-01-24T11:12:30Z
last-modified: 2011-01-24T11:12:30Z
source: RIPE # Filtered

role: OVH Technical Contact
address: OVH SAS
address: 2 rue Kellermann
address: 59100 Roubaix
address: France
admin-c: OK217-RIPE
tech-c: GM84-RIPE
tech-c: SL10162-RIPE
nic-hdl: OTC2-RIPE
mnt-by: OVH-MNT
created: 2004-01-28T17:42:29Z
last-modified: 2014-09-05T10:47:15Z
source: RIPE # Filtered

person: Octave Klaba
address: OVH SAS
address: 2 rue Kellermann
address: 59100 Roubaix
address: France
phone: +33 9 74 53 13 23
nic-hdl: OK217-RIPE
mnt-by: OVH-MNT
created: 1970-01-01T00:00:00Z
last-modified: 2017-10-30T21:44:51Z
source: RIPE # Filtered

Information related to

descr: OVH ISP
descr: Paris, France
origin: AS16276
mnt-by: OVH-MNT
created: 2011-01-06T17:04:52Z
last-modified: 2011-01-06T17:04:52Z
source: RIPE # Filtered
by mwinf5c62 with ME
id 4EPn200185R6BCm01EPnhy; Wed, 24 Apr 2019 16:23:47 +0200
X-ME-engine: default
X-me-spamcause: (37)(0000)gggruggvucftvghtrhhoucdtuddrgeduuddrhedugdduvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecugedttdenucgfrhhlucfvnfffucdljedmneforghilhcuufhprhhinhhgucdlfedtmdenucfjughrpegghffvfffutgfgkfeshhhqtddttddtvdenucfhrhhomhepkfhnfhhouceomhhmqhgsphhnihgsugiisehsqdhvvghrihhfrdhtkheqnecuffhomhgrihhnpehpphhlihhmihhtrghtihhonhhstghomhhpthgvshdrfhhrnecukfhppeegiedruddthedrfeegrddvhedupdekvddrvdeggedrtddrvddvgeenucfrrghrrghmpehhvghlohepmhhohedvkedrmhgrihhlqdhouhhtrdhovhhhrdhnvghtpdhinhgvthepgeeirddutdehrdefgedrvdehuddpmhgrihhlfhhrohhmpehmmhhqsghpnhhisgguiiesshdqvhgvrhhifhdrthhkpdhrtghpthhtohepphhhihhlihhpphgvrdgtohhquhgvtheikeejsehorhgrnhhgvgdrfhhrnecuvehluhhsthgvrhfuihiivgeptd
X-me-spamlevel: not-spam
X-ME-Entity: ofr
Received: from DAG4EX2.emp.local (unknown [])

Whois IP

OrgAbuseHandle: IANA-IP-ARIN
OrgAbuseName: ICANN
OrgAbusePhone: +1-310-301-5820

by (Postfix) with ESMTPS id 20A0EDB0E8F
for; Wed, 24 Apr 2019 16:23:47 +0200 (CEST)
Received: from K4R4Z ( by DAG4EX2.emp.local ( with Microsoft SMTP Server (version=TLS1_2,
cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.1.1713.5; Wed, 24 Apr 2019 16:23:46 +0200
MIME-Version: 1.0

Whois IP

OrgAbuseHandle: IANA-IP-ARIN
OrgAbuseName: ICANN
OrgAbusePhone: +1-310-301-5820

From: Info
Date: Wed, 24 Apr 2019 16:23:46 +0200
Subject: =?utf-8?B?Vm90cmUgY29tcHRlIGEgw6l0w6kgbGltaXTDqQ==?=
Content-Type: text/html; charset="us-ascii"
Content-Transfer-Encoding: quoted-printable
Message-ID: 936e0514-755e-47f9-8c0a-c21d4dfcbaba@DAG4EX2.emp.local
X-Originating-IP: []

Whois IP

Information related to -

Abuse contact for - is

inetnum: -
descr: Proxad / Free SAS
descr: Static pool (Freebox)
descr: nak11-1 (perpignan)
descr: NCC#2005090519
country: FR
admin-c: ACP23-RIPE
tech-c: TCP8-RIPE
remarks: Spam/Abuse requests:
mnt-by: PROXAD-MNT
created: 2005-09-29T13:49:14Z
last-modified: 2005-09-29T13:49:14Z
source: RIPE

role: Administrative / Technical Contacts for ProXad
address: Free SAS / ProXad
address: 8, rue de la Ville L'Eveque
address: 75008 Paris
phone: +33 1 73 50 20 00
fax-no: +33 1 73 92 25 69
remarks: trouble: Information:
remarks: trouble: Spam/Abuse requests: mailto:
admin-c: APfP1-RIPE
tech-c: TPfP1-RIPE
nic-hdl: ACP23-RIPE
mnt-by: PROXAD-MNT
created: 2002-06-26T12:46:56Z
last-modified: 2013-08-01T12:16:00Z
source: RIPE # Filtered

Information related to

descr: ProXad network / Free SAS
descr: Paris, France
origin: AS12322
mnt-by: PROXAD-MNT
created: 2003-11-04T13:26:17Z
last-modified: 2003-11-04T13:26:17Z
source: RIPE # Filtered
X-ClientProxiedBy: DAG4EX2.emp.local ( To DAG4EX2.emp.local (

Whois IP

OrgAbuseHandle: IANA-IP-ARIN
OrgAbuseName: ICANN
OrgAbusePhone: +1-310-301-5820

X-Ovh-Tracer-Id: 8174877750454615329
X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduuddrhedugddugecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfqggfjpdevjffgvefmvefgnecuuegrihhlohhuthemucehtddtnecufghrlhcuvffnffculddutddmneforghilhcuufhprhhinhhgucdlfedtmd

status: ACTIVE
hold: NO
holder-c: ANO00-FRNIC
admin-c: ANO00-FRNIC
tech-c: OVH5-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL105512-FRNIC
registrar: OVH
Expiry Date: 2020-03-19T12:33:02Z
created: 2019-03-19T12:33:02Z
last-update: 2019-04-18T07:52:57Z
source: FRNIC

ns-list: NSL105512-FRNIC
source: FRNIC

registrar: OVH
type: Isp Option 1
address: 2 Rue Kellermann
address: 59100 ROUBAIX
country: FR
phone: +33 8 99 70 17 61
fax-no: +33 3 20 20 09 58
anonymous: NO
registered: 1999-10-21T12:00:00Z
source: FRNIC

nic-hdl: ANO00-FRNIC
type: PERSON
contact: Ano Nymous
remarks: -------------- WARNING --------------
While the registrar knows him/her, this person chose to restrict access to his/her personal data. So PLEASE, don't send emails to Ano Nymous. This address is bogus and there is no hope of a reply.
remarks: -------------- WARNING --------------
registrar: OVH
changed: 2019-04-16T15:35:19Z anonymous@anonymous
anonymous: YES
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: OVH5-FRNIC
type: ROLE
contact: OVH NET
address: OVH
address: 140, quai du Sartel
address: 59100 Roubaix
country: FR
phone: +33 8 99 70 17 61
trouble: Information:
trouble: Questions: mailto:
trouble: Spam: mailto:
admin-c: OK217-FRNIC
tech-c: OK217-FRNIC
registrar: OVH
changed: 2006-10-11T08:41:58Z
anonymous: NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC


Cher(e) client(e),
Vous devez confirmer votre compte PayPaI

Nous avons limiter votre compte en raison d'une connexion inhabituelle. Cliquez sur le bouton "Se connecter" ci dessous pour confirmer vos informations.

Se connecter (pp = paypal limitations comptes fr)

? 2019

status: ACTIVE
hold: NO
holder-c: JX225-FRNIC
admin-c: JX225-FRNIC
tech-c: KSG121-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL101115-FRNIC
registrar: KEY-SYSTEMS GmbH
Expiry Date: 2020-04-18T16:51:28Z
created: 2019-04-18T16:51:28Z
last-update: 2019-04-18T16:51:30Z
source: FRNIC

ns-list: NSL101115-FRNIC
source: FRNIC

registrar: KEY-SYSTEMS GmbH
type: Isp Option 1
address: Im Oberen Werk 1
address: DE-66386 Sankt INGBERT
country: DE (Deutschland / Allemagne)
phone: +49 68 94 93 96 850
fax-no: +49 68 94 93 96 851
anonymous: NO
registered: 2006-07-25T12:00:00Z
source: FRNIC

nic-hdl: JX225-FRNIC
type: PERSON
contact: Julien Xawar
address: 9 rue arago
address: 11100 Narbonne
country: FR
phone: +33.756953861
registrar: KEY-SYSTEMS GmbH
changed: 2019-04-18T16:51:24Z
anonymous: NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC
Commentaire / ExplicationsArnaque phishing qui vous demande de se connecter pour taper votre adresse email personnelle et le mot de passe pour vous voler vos coordonnées personnelles
et accéder à votre insu sur votre compte (ce qui n’est pas cas mon personnellement) sous prétexte quelconque : « Nous avons limiter votre compte en raison d'une connexion inhabituelle. Cliquez sur le bouton "Se connecter" ci dessous pour confirmer vos informations. »

Pas concerné vu que je n’ai aucun compte chez PayPal et je n’utilise jamais cette plateforme de paiement en ligne pour des achats quelconques.

Fautes d’orthographe qui vous sautent aux yeux comme d’habitude.

Une interrogation qui précède l’année en cours « ? 2019 »


Comment reconnaître un email frauduleux ?

Découvrez les gestes simples pour vous protèger contre le phishing :

1. Soyez attentifs aux liens suspects. Soyez extrêmement prudent lorsque l'on vous demande de cliquer sur un lien dans un email qui semble provenir de PayPal.

2. Nous ne vous demanderons jamais de saisir vos informations personnelles ou financières.

3. Nous ne vous enverrons jamais une pièce jointe ou une mise à jour de logiciel à installer sur votre ordinateur.

Nous ne vous enverrons jamais une pièce jointe ou une mise à jour de logiciel à installer sur votre ordinateur.

Lorsque vous recevez un email suspect ou frauduleux, transférez-le dans son intégralité (informations d'en-tête incluses et sans commentaire/remarque supplémentaire) à .

Ne le conservez que si vous portez plainte auprès des services de police car ils vous en demanderont une copie. Sinon, supprimez-le de votre messagerie.

Que faire en cas d'e-mail frauduleux et d'activité suspecte.

La protection de vos données est notre priorité, c'est pourquoi nous nous y consacrons en permanence. Il est important d'acquérir quelques réflexes simples pour vous protéger contre le phishing.

Comment identifier les e-mails frauduleux ?

Vérifiez l'adresse de l'expéditeur

Repérez les adresses inhabituelles. En France, une adresse PayPal valide doit contenir le nom de domaine

N'agissez pas dans l'urgence

De nombreux e-mails frauduleux prétendent que votre compte sera supprimé si vous n'effectuez pas immédiatement une mise à jour essentielle. C'est totalement faux.

Commencez par vérifier votre compte PayPal

Si un e-mail suspect prétend que vous avez reçu de l'argent, connectez-vous à votre compte PayPal pour vérifier qu'il ne s'agit pas d’une arnaque.

Méfiez-vous des salutations génériques

PayPal n'utilise jamais d'expressions telles que "Cher utilisateur", ou "Cher [adresse e-mail]" dans ses e-mails.

Prêtez attention aux fautes d'orthographe et de grammaire

Généralement, les e-mails envoyés par des entreprises dignes de confiance ne contiennent pas de fautes d'orthographe ou de grammaire. Si vous en relevez plusieurs, il s'agit probablement d'une tentative de phishing.

N'ouvrez pas les pièces jointes

PayPal n'envoie jamais d'e-mails contenant des pièces jointes. À moins d'avoir la certitude qu'elle est légitime, n'ouvrez jamais une pièce jointe, car elle peut contenir un virus ou un logiciel espion.

Préservez votre sécurité en ligne

Vous avez cliqué sur un lien contenu dans un e-mail suspect ?

Pas de panique. Avec ces quelques astuces, vous repérerez facilement les imposteurs.

Même si une URL contient le mot "PayPal", la page correspondante n'est pas forcément légitime.

Si vous avez communiqué vos informations personnelles en réponse à un e-mail de phishing ou sur un site frauduleux, modifiez immédiatement votre mot de passe PayPal et vos questions secrètes.

Lorsque vous utilisez PayPal, vérifiez systématiquement que l'URL qui apparaît en haut de l'écran s'affiche comme Le "s" de "https" indique que le site est sécurisé.

Si vous avez dévoilé vos informations financières, contactez votre banque et l'émetteur de votre carte bancaire afin de leur faire part de la situation.

Vérifiez que le symbole de verrouillage apparaît bien dans la barre d'adresse. Ce symbole indique que vous vous trouvez sur un site sécurisé.

Consultez l'historique de vos transactions PayPal pour vérifier la légitimité de tous vos paiements récents.

Comment éviter les arnaques sur des sites de petites annonces ?

Bien que la majorité des transactions en ligne se passent sans problème, certaines personnes malveillantes peuvent envoyer de faux e-mails PayPal.

Si vous vendez sur des sites de petites annonces, méfiez-vous des e-mails :

Prétendument envoyés par PayPal mais depuis une adresse Gmail ou d'une autre messagerie. En France, une adresse PayPal valide doit contenir le nom de domaine

Vous informant de la réception d’un paiement par PayPal.

Vous invitant à faire parvenir un numéro de suivi à PayPal pour récupérer votre argent.

Ayez le bon réflexe :

Si vous ne voyez pas le paiement sur votre compte PayPal, n’envoyez pas l’objet.

Si vous avez déjà envoyé l’objet, contactez immédiatement la société d’expédition afin de stopper la livraison.

Que faire si vous recevez un e-mail potentiellement frauduleux ?

1 - Transférez l'e-mail dans son intégralité à

2 - Ne modifiez pas l'objet du message et ne le transférez pas sous forme de pièce jointe

3 - Supprimez l'e-mail suspect de votre messagerie
Piece(s) jointe(s)
Autres Références
Pour en Savoir +A découvrir: Fonctionnement de l'Arnaque "Paypal"
Utiliser Google pour esquiver les Arnaques...
Numéro de téléphone dangereux détecté dans ce signalement d'arnaque: Lisez cet article.
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !
Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Italien Allemand Espagnol