Autre arnaque : Entreprise HUGUET

ARNAQUE SUSPECTÉE !!!

Date12/06/2019
Pseudonyme utiliséEntreprise HUGUET
Contenu de l'arnaqueBonjour,

Notre service logistique a confirmé l'expédition de votre colis.
Vous trouverez ici un duplicata de votre bon de livraison numéro 458128.
En vous remerciant pour votre confiance.
Pour toutes informations complémentaires, vous pouvez nous contacter au numéro indiqué dans votre facture.

Return-Path:
Received: from mwinf5c05 (mwinf5c05 [10.223.111.55])
by mwinb2105 with LMTPA;
Wed, 12 Jun 2019 04:58:32 +0200
X-Sieve: CMU Sieve 2.3
Received: from cequemangentleschefs.fr ([86.222.116.16])
by mwinf5c05 with ME
id PeyY200030MJCvq01eyYEJ; Wed, 12 Jun 2019 04:58:32 +0200
X-bcc: fr.dubois5@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (0)(0000)gggruggvucftvghtrhhoucdtuddrgeduuddrudehiedgieegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrihhlohhuthemucegtddtnecunecujfgurhepuffktgffhffvsehhtdfstddttdejnecuhfhrohhmpefgnhhtrhgvphhrihhsvgcujfgfifgfgffvuceotghonhhtrggtthestggvqhhuvghmrghnghgvnhhtlhgvshgthhgvfhhsrdhfrheqnecukfhppeekiedrvddvvddrudduiedrudeinecurfgrrhgrmhephhgvlhhopegtvghquhgvmhgrnhhgvghnthhlvghstghhvghfshdrfhhrpdhinhgvthepkeeirddvvddvrdduudeirdduiedpmhgrihhlfhhrohhmpegtohhnthgrtghtsegtvghquhgvmhgrnhhgvghnthhlvghstghhvghfshdrfhhrpdhrtghpthhtohepfhhrrdguuhgsohhishehsehorhgrnhhgvgdrfhhrnecuvehluhhsthgvrhfuihiivgeptd
X-me-spamlevel: not-spam
X-ME-Helo: cequemangentleschefs.fr
X-ME-IP: 86.222.116.16
X-ME-Entity: ofr
X-2144156292: 548507653
Subject: =?utf-8?B?RmFjdHVyZQ==?=
X-1723250971: 763840695
X-1315361084: 473270445
X-277662067: 550974306
X-1103989077: 1332563348
X-1519607158: 764511758
X-1312251892: 498672548
X-177280753: 115063320
X-751158180: 1868190100
X-1687336284: 1042705984
X-1400626461: 1706982503
X-2082320423: 1510165128
X-1922628588: 245576669
X-102183563: 1612580270
X-38047296: 461474334
X-Sieve: CMU Sieve 2.3
X-131160476: 1258103764
X-1939635536: 1125817337
Message-ID:
X-232207522: 1436381387
X-1747743382: 1266707902
Content-Type: text/html
X-1862250736: 697001913
X-1045070270: 1742854615
X-778136887: 74655536
X-903217205: 1855433241
X-125333654: 2015118219
X-302942847: 2047089924
Date: Wed, 12 Jun 2019 04:58:31 +0200
X-2058002845: 965484637
From: Entreprise HUGUET
X-1150375929: 1471776512
X-1693458795: 134719606
X-142627242: 758621301
X-1055253882: 2126871534
X-1343646582: 230384504
X-1099180961: 1844014346
X-2078370555: 366146312
X-1237342857: 767396026
X-2063074395: 389816542
X-691281565: 600883266
X-2043007181: 606097461
X-2061628058: 505852550
To: 969048350
X-1566107782: 2135128920
X-1978914347: 746830088
X-11811896: 144214515
X-728964910: 1287851965
X-Antivirus: Avast (VPS 190611-4, 11/06/2019), Inbound message
X-Antivirus-Status: Clean
Votre Commentaire / Vos Explicationspas de commande
pas d’identification de l’entreprise
pas de contact (tel, etc..)
classé pas très fiable par SCAMDOC
Arnaque très fortement probable
Pour en Savoir +Numéro de téléphone dangereux détecté dans ce signalement d'arnaque: Lisez cet article.
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !
Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Italien Allemand Espagnol