Arnaque identité (Phishing) : sellig94@noos.fr Brigitte GASNIER

ARNAQUE SUSPECTÉE !!!

Date23/06/2019
Email frauduleuxsellig94@noos.fr
Pseudonyme utiliséBrigitte GASNIER
Contenu de l'arnaquerigitte GASNIER"
ajouter à mes contacts
créer une alerte SMS
à sellig94@noos.fr
date 23/06/19 20:16
objet tr: BULLETIN DE PAIE -
fermer l'en-tête

Return-Path:

Received: from mwinf5c22 (mwinf5c22 [10.223.111.72])
by mwinb2c04 with LMTPA;
Sun, 23 Jun 2019 20:16:19 +0200

X-Sieve: CMU Sieve 2.3

Received: from smtp1.tech.numericable.fr ([82.216.111.37])
by mwinf5c22 with ME
id UJFj2001j0oToaS01JFk7F; Sun, 23 Jun 2019 20:16:19 +0200

X-bcc: gc.cam@wanadoo.fr

X-ME-bounce-domain: wanadoo.fr

X-ME-engine: default

X-me-spamcause: (-308)(0000)gggruggvucftvghtrhhoucdtuddrgeduvddruddtgdduvdekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrih
hlohhuthemucegtddtnecundfqrhgrnhhgvgeurggutfgvphhuthfkphculddqfedtkedmnecujfgurhephffvfffurfggoffktgesmhdttderredtjeenucfhrhhomhep
fdeurhhighhithhtvgcuifetuffpkffgtfdfuceoshgvlhhlihhgleegsehnohhoshdrfhhrqeenucfkphepkedvrddvudeirdduuddurdefjedpfeejrdduvddtrdduge
efrdduvdenucfrrghrrghmpehhvghlohepshhmthhpuddrthgvtghhrdhnuhhmvghrihgtrggslhgvrdhfrhdpihhnvghtpeekvddrvdduiedrudduuddrfeejpdhmrghi
lhhfrhhomhepshgvlhhlihhgleegsehnohhoshdrfhhrpdhrtghpthhtohepghgtsghmseifrghnrgguohhordhfrhdpmhhouggvpehsmhhtphhouhhtnecuvehluhhsth
gvrhfuihiivgeptd

X-me-spamlevel: not-spam

X-ME-Helo: smtp1.tech.numericable.fr

X-ME-IP: 82.216.111.37

X-ME-Entity: ofr

Received: from mowmail-nc4.nc.sdv.fr (mowmail-nc4.tech.numericable.fr [82.216.111.104])
by smtp1.tech.numericable.fr (Postfix) with SMTP id AE4F8146C45;
Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

Received: from [37.120.143.12] by webmail.numericable.fr with http webmail;
Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

X-EA-Auth: +dMdE6okMTKk+o7IC5Yttwd+CsMDqA0r8RwRuLiz7FmNZa9L2lb1mOZ8KfZ
fMqPSIJfSbKDR3lw=

From: "Brigitte GASNIER"

To: sellig94@noos.fr

Date: Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

Subject: tr: BULLETIN DE PAIE -

X-Priority: 3

MIME-Version: 1.0

X-Mailer: COMS/EA14.11/r20171018

Message-ID:

Content-Type: multipart/mixed;
boundary="----=_NextPart_000_5d0fc096_b660_4fcf1701"

X-VR-SPAMSTATE: OK

X-VR-SPAMSCORE: 15

X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddruddtgdduvdeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecupfgfoffgtffkveetuefngfdpqfgfvfenuceurg
hilhhouhhtmecufedttdenucgoteeftdduqddtudculdduhedmnecujfgurhephffvfffurfggoffktgesmhdttderredtjeenucfhrhhomhepfdeurhhighhithhtvgcu
ifetuffpkffgtfdfuceoshgvlhhlihhgleegsehnohhoshdrfhhrqeenucfkphepfeejrdduvddtrddugeefrdduvdenucfrrghrrghmpehmohguvgepshhmthhpohhuth
enucevlhhushhtvghrufhiiigvpedt
pièce(s) jointe(s) 1 fichier(s)

OIUP159.png
(265.16 ko)
télécharger
voir
fermer détails

ajouter au Cloud

Madame/Monsieur,

Nous avons le plaisir de vous informer que grâce à votre émail, vous êtes bénéficiaire à MEGA-MILLION sis à WASHINGTON.

Ce qui signifie que vous empochez la somme de SIX CENT CINQUANTE mille € à la deuxième place lors du tirage .Après prise de connaissance des fichiers joints, prière de prendre contacte avec le responsable accrédité en lui fournissant vos informations demandées par notre Direction

Cordialement.
rigitte GASNIER"
ajouter à mes contacts
créer une alerte SMS
à sellig94@noos.fr
date 23/06/19 20:16
objet tr: BULLETIN DE PAIE -
fermer l'en-tête

Return-Path:

Received: from mwinf5c22 (mwinf5c22 [10.223.111.72])
by mwinb2c04 with LMTPA;
Sun, 23 Jun 2019 20:16:19 +0200

X-Sieve: CMU Sieve 2.3

Received: from smtp1.tech.numericable.fr ([82.216.111.37])
by mwinf5c22 with ME
id UJFj2001j0oToaS01JFk7F; Sun, 23 Jun 2019 20:16:19 +0200

X-bcc: gc.cam@wanadoo.fr

X-ME-bounce-domain: wanadoo.fr

X-ME-engine: default

X-me-spamcause: (-308)(0000)gggruggvucftvghtrhhoucdtuddrgeduvddruddtgdduvdekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrih
hlohhuthemucegtddtnecundfqrhgrnhhgvgeurggutfgvphhuthfkphculddqfedtkedmnecujfgurhephffvfffurfggoffktgesmhdttderredtjeenucfhrhhomhep
fdeurhhighhithhtvgcuifetuffpkffgtfdfuceoshgvlhhlihhgleegsehnohhoshdrfhhrqeenucfkphepkedvrddvudeirdduuddurdefjedpfeejrdduvddtrdduge
efrdduvdenucfrrghrrghmpehhvghlohepshhmthhpuddrthgvtghhrdhnuhhmvghrihgtrggslhgvrdhfrhdpihhnvghtpeekvddrvdduiedrudduuddrfeejpdhmrghi
lhhfrhhomhepshgvlhhlihhgleegsehnohhoshdrfhhrpdhrtghpthhtohepghgtsghmseifrghnrgguohhordhfrhdpmhhouggvpehsmhhtphhouhhtnecuvehluhhsth
gvrhfuihiivgeptd

X-me-spamlevel: not-spam

X-ME-Helo: smtp1.tech.numericable.fr

X-ME-IP: 82.216.111.37

X-ME-Entity: ofr

Received: from mowmail-nc4.nc.sdv.fr (mowmail-nc4.tech.numericable.fr [82.216.111.104])
by smtp1.tech.numericable.fr (Postfix) with SMTP id AE4F8146C45;
Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

Received: from [37.120.143.12] by webmail.numericable.fr with http webmail;
Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

X-EA-Auth: +dMdE6okMTKk+o7IC5Yttwd+CsMDqA0r8RwRuLiz7FmNZa9L2lb1mOZ8KfZ
fMqPSIJfSbKDR3lw=

From: "Brigitte GASNIER"

To: sellig94@noos.fr

Date: Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

Subject: tr: BULLETIN DE PAIE -

X-Priority: 3

MIME-Version: 1.0

X-Mailer: COMS/EA14.11/r20171018

Message-ID:

Content-Type: multipart/mixed;
boundary="----=_NextPart_000_5d0fc096_b660_4fcf1701"

X-VR-SPAMSTATE: OK

X-VR-SPAMSCORE: 15

X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddruddtgdduvdeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecupfgfoffgtffkveetuefngfdpqfgfvfenuceurg
hilhhouhhtmecufedttdenucgoteeftdduqddtudculdduhedmnecujfgurhephffvfffurfggoffktgesmhdttderredtjeenucfhrhhomhepfdeurhhighhithhtvgcu
ifetuffpkffgtfdfuceoshgvlhhlihhgleegsehnohhoshdrfhhrqeenucfkphepfeejrdduvddtrddugeefrdduvdenucfrrghrrghmpehmohguvgepshhmthhpohhuth
enucevlhhushhtvghrufhiiigvpedt
pièce(s) jointe(s) 1 fichier(s)

OIUP159.png
(265.16 ko)
télécharger
voir
fermer détails

ajouter au Cloud

Madame/Monsieur,

Nous avons le plaisir de vous informer que grâce à votre émail, vous êtes bénéficiaire à MEGA-MILLION sis à WASHINGTON.

Ce qui signifie que vous empochez la somme de SIX CENT CINQUANTE mille € à la deuxième place lors du tirage .Après prise de connaissance des fichiers joints, prière de prendre contacte avec le responsable accrédité en lui fournissant vos informations demandées par notre Direction

Cordialement.
rigitte GASNIER"
ajouter à mes contacts
créer une alerte SMS
à sellig94@noos.fr
date 23/06/19 20:16
objet tr: BULLETIN DE PAIE -
fermer l'en-tête

Return-Path:

Received: from mwinf5c22 (mwinf5c22 [10.223.111.72])
by mwinb2c04 with LMTPA;
Sun, 23 Jun 2019 20:16:19 +0200

X-Sieve: CMU Sieve 2.3

Received: from smtp1.tech.numericable.fr ([82.216.111.37])
by mwinf5c22 with ME
id UJFj2001j0oToaS01JFk7F; Sun, 23 Jun 2019 20:16:19 +0200

X-bcc: gc.cam@wanadoo.fr

X-ME-bounce-domain: wanadoo.fr

X-ME-engine: default

X-me-spamcause: (-308)(0000)gggruggvucftvghtrhhoucdtuddrgeduvddruddtgdduvdekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrih
hlohhuthemucegtddtnecundfqrhgrnhhgvgeurggutfgvphhuthfkphculddqfedtkedmnecujfgurhephffvfffurfggoffktgesmhdttderredtjeenucfhrhhomhep
fdeurhhighhithhtvgcuifetuffpkffgtfdfuceoshgvlhhlihhgleegsehnohhoshdrfhhrqeenucfkphepkedvrddvudeirdduuddurdefjedpfeejrdduvddtrdduge
efrdduvdenucfrrghrrghmpehhvghlohepshhmthhpuddrthgvtghhrdhnuhhmvghrihgtrggslhgvrdhfrhdpihhnvghtpeekvddrvdduiedrudduuddrfeejpdhmrghi
lhhfrhhomhepshgvlhhlihhgleegsehnohhoshdrfhhrpdhrtghpthhtohepghgtsghmseifrghnrgguohhordhfrhdpmhhouggvpehsmhhtphhouhhtnecuvehluhhsth
gvrhfuihiivgeptd

X-me-spamlevel: not-spam

X-ME-Helo: smtp1.tech.numericable.fr

X-ME-IP: 82.216.111.37

X-ME-Entity: ofr

Received: from mowmail-nc4.nc.sdv.fr (mowmail-nc4.tech.numericable.fr [82.216.111.104])
by smtp1.tech.numericable.fr (Postfix) with SMTP id AE4F8146C45;
Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

Received: from [37.120.143.12] by webmail.numericable.fr with http webmail;
Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

X-EA-Auth: +dMdE6okMTKk+o7IC5Yttwd+CsMDqA0r8RwRuLiz7FmNZa9L2lb1mOZ8KfZ
fMqPSIJfSbKDR3lw=

From: "Brigitte GASNIER"

To: sellig94@noos.fr

Date: Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

Subject: tr: BULLETIN DE PAIE -

X-Priority: 3

MIME-Version: 1.0

X-Mailer: COMS/EA14.11/r20171018

Message-ID:

Content-Type: multipart/mixed;
boundary="----=_NextPart_000_5d0fc096_b660_4fcf1701"

X-VR-SPAMSTATE: OK

X-VR-SPAMSCORE: 15

X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddruddtgdduvdeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecupfgfoffgtffkveetuefngfdpqfgfvfenuceurg
hilhhouhhtmecufedttdenucgoteeftdduqddtudculdduhedmnecujfgurhephffvfffurfggoffktgesmhdttderredtjeenucfhrhhomhepfdeurhhighhithhtvgcu
ifetuffpkffgtfdfuceoshgvlhhlihhgleegsehnohhoshdrfhhrqeenucfkphepfeejrdduvddtrddugeefrdduvdenucfrrghrrghmpehmohguvgepshhmthhpohhuth
enucevlhhushhtvghrufhiiigvpedt
pièce(s) jointe(s) 1 fichier(s)

OIUP159.png
(265.16 ko)
télécharger
voir
fermer détails

ajouter au Cloud

Madame/Monsieur,

Nous avons le plaisir de vous informer que grâce à votre émail, vous êtes bénéficiaire à MEGA-MILLION sis à WASHINGTON.

Ce qui signifie que vous empochez la somme de SIX CENT CINQUANTE mille € à la deuxième place lors du tirage .Après prise de connaissance des fichiers joints, prière de prendre contacte avec le responsable accrédité en lui fournissant vos informations demandées par notre Direction

Cordialement.
Commentaire / Explicationstentative de phishing
Pour en Savoir +Comment signaler une arnaque de Phishing ?
Article: Qu'est-ce que le Phishing ?
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !

2 commentaires


  • Fraud Watcher/Advisor le 23/06/2019 à 22:32

    Arnaque confirmée à propos de l'utilisation et d'usurpation abusives d'identité non autorisée des marques de service, des logos et des noms commerciaux de Mega Millions®

    Les escroqueries de Mega Millions se présentent généralement sous la forme de fraudes payées à l’avance, qui impliquent un fraudeur qui contacte à tort des personnes prétendant qu’elles doivent payer une grosse somme d’argent.

    Sur cette page, vous trouverez les différents types d’escroqueries que les joueurs de loterie devraient connaître et des conseils pour les éviter. Il est important de noter qu'il n'est pas possible de gagner un prix pour une loterie que vous n'avez pas encore inscrite et les représentants de Mega Millions ne vous contacteront jamais au sujet d'un gain ou de frais avant que vous ne receviez vos gains.... Lire la suite

    Répondre
  • Fraud Watcher/Advisor le 23/06/2019 à 22:47

    A propos de cette adresse IP address 82.216.111.37 qui confirme l'origine de sa provenance via ce serveur / hébergeur / fournisseur d'accès internet et de leur datacenter de SFR SA / Numericable :

    Pour des problèmes de piratage, de spam, d'abus frauduleux ou de sécurité, envoyer un mail à :

    abuse@gaoland.net

    Information related to 82.216.0.0 - 82.216.255.255

    Abuse contact for 82.216.0.0 - 82.216.255.255 is abuse@gaoland.net

    inetnum: 82.216.0.0 - 82.216.255.255
    netname: FR-SFR-20031022
    country: FR(ANCE)
    org: ORG-VF1-RIPE
    admin-c: LD699-RIPE
    tech-c: LDC76-RIPE
    status: ALLOCATED PA
    mnt-by: RIPE-NCC-HM-MNT
    mnt-by: SFR-MNT
    mnt-routes: SFR-MNT
    created: 2017-12-28T10:57:17Z
    last-modified: 2017-12-28T10:57:17Z
    source: RIPE

    organisation: ORG-VF1-RIPE
    org-name: SFR SA... Lire la suite

    Répondre
Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Italien Allemand Espagnol