Arnaque identité (Phishing) : sellig94@noos.fr Brigitte GASNIER

ARNAQUE SUSPECTÉE !!!

Date23/06/2019
Email frauduleuxsellig94@noos.fr
Pseudonyme utiliséBrigitte GASNIER
Contenu de l'arnaquerigitte GASNIER"
ajouter à mes contacts
créer une alerte SMS
à sellig94@noos.fr
date 23/06/19 20:16
objet tr: BULLETIN DE PAIE -
fermer l'en-tête

Return-Path:

Received: from mwinf5c22 (mwinf5c22 [10.223.111.72])
by mwinb2c04 with LMTPA;
Sun, 23 Jun 2019 20:16:19 +0200

X-Sieve: CMU Sieve 2.3

Received: from smtp1.tech.numericable.fr ([82.216.111.37])
by mwinf5c22 with ME
id UJFj2001j0oToaS01JFk7F; Sun, 23 Jun 2019 20:16:19 +0200

X-bcc: gc.cam@wanadoo.fr

X-ME-bounce-domain: wanadoo.fr

X-ME-engine: default

X-me-spamcause: (-308)(0000)gggruggvucftvghtrhhoucdtuddrgeduvddruddtgdduvdekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrih
hlohhuthemucegtddtnecundfqrhgrnhhgvgeurggutfgvphhuthfkphculddqfedtkedmnecujfgurhephffvfffurfggoffktgesmhdttderredtjeenucfhrhhomhep
fdeurhhighhithhtvgcuifetuffpkffgtfdfuceoshgvlhhlihhgleegsehnohhoshdrfhhrqeenucfkphepkedvrddvudeirdduuddurdefjedpfeejrdduvddtrdduge
efrdduvdenucfrrghrrghmpehhvghlohepshhmthhpuddrthgvtghhrdhnuhhmvghrihgtrggslhgvrdhfrhdpihhnvghtpeekvddrvdduiedrudduuddrfeejpdhmrghi
lhhfrhhomhepshgvlhhlihhgleegsehnohhoshdrfhhrpdhrtghpthhtohepghgtsghmseifrghnrgguohhordhfrhdpmhhouggvpehsmhhtphhouhhtnecuvehluhhsth
gvrhfuihiivgeptd

X-me-spamlevel: not-spam

X-ME-Helo: smtp1.tech.numericable.fr

X-ME-IP: 82.216.111.37

X-ME-Entity: ofr

Received: from mowmail-nc4.nc.sdv.fr (mowmail-nc4.tech.numericable.fr [82.216.111.104])
by smtp1.tech.numericable.fr (Postfix) with SMTP id AE4F8146C45;
Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

Received: from [37.120.143.12] by webmail.numericable.fr with http webmail;
Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

X-EA-Auth: +dMdE6okMTKk+o7IC5Yttwd+CsMDqA0r8RwRuLiz7FmNZa9L2lb1mOZ8KfZ
fMqPSIJfSbKDR3lw=

From: "Brigitte GASNIER"

To: sellig94@noos.fr

Date: Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

Subject: tr: BULLETIN DE PAIE -

X-Priority: 3

MIME-Version: 1.0

X-Mailer: COMS/EA14.11/r20171018

Message-ID:

Content-Type: multipart/mixed;
boundary="----=_NextPart_000_5d0fc096_b660_4fcf1701"

X-VR-SPAMSTATE: OK

X-VR-SPAMSCORE: 15

X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddruddtgdduvdeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecupfgfoffgtffkveetuefngfdpqfgfvfenuceurg
hilhhouhhtmecufedttdenucgoteeftdduqddtudculdduhedmnecujfgurhephffvfffurfggoffktgesmhdttderredtjeenucfhrhhomhepfdeurhhighhithhtvgcu
ifetuffpkffgtfdfuceoshgvlhhlihhgleegsehnohhoshdrfhhrqeenucfkphepfeejrdduvddtrddugeefrdduvdenucfrrghrrghmpehmohguvgepshhmthhpohhuth
enucevlhhushhtvghrufhiiigvpedt
pièce(s) jointe(s) 1 fichier(s)

OIUP159.png
(265.16 ko)
télécharger
voir
fermer détails

ajouter au Cloud

Madame/Monsieur,

Nous avons le plaisir de vous informer que grâce à votre émail, vous êtes bénéficiaire à MEGA-MILLION sis à WASHINGTON.

Ce qui signifie que vous empochez la somme de SIX CENT CINQUANTE mille € à la deuxième place lors du tirage .Après prise de connaissance des fichiers joints, prière de prendre contacte avec le responsable accrédité en lui fournissant vos informations demandées par notre Direction

Cordialement.
rigitte GASNIER"
ajouter à mes contacts
créer une alerte SMS
à sellig94@noos.fr
date 23/06/19 20:16
objet tr: BULLETIN DE PAIE -
fermer l'en-tête

Return-Path:

Received: from mwinf5c22 (mwinf5c22 [10.223.111.72])
by mwinb2c04 with LMTPA;
Sun, 23 Jun 2019 20:16:19 +0200

X-Sieve: CMU Sieve 2.3

Received: from smtp1.tech.numericable.fr ([82.216.111.37])
by mwinf5c22 with ME
id UJFj2001j0oToaS01JFk7F; Sun, 23 Jun 2019 20:16:19 +0200

X-bcc: gc.cam@wanadoo.fr

X-ME-bounce-domain: wanadoo.fr

X-ME-engine: default

X-me-spamcause: (-308)(0000)gggruggvucftvghtrhhoucdtuddrgeduvddruddtgdduvdekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrih
hlohhuthemucegtddtnecundfqrhgrnhhgvgeurggutfgvphhuthfkphculddqfedtkedmnecujfgurhephffvfffurfggoffktgesmhdttderredtjeenucfhrhhomhep
fdeurhhighhithhtvgcuifetuffpkffgtfdfuceoshgvlhhlihhgleegsehnohhoshdrfhhrqeenucfkphepkedvrddvudeirdduuddurdefjedpfeejrdduvddtrdduge
efrdduvdenucfrrghrrghmpehhvghlohepshhmthhpuddrthgvtghhrdhnuhhmvghrihgtrggslhgvrdhfrhdpihhnvghtpeekvddrvdduiedrudduuddrfeejpdhmrghi
lhhfrhhomhepshgvlhhlihhgleegsehnohhoshdrfhhrpdhrtghpthhtohepghgtsghmseifrghnrgguohhordhfrhdpmhhouggvpehsmhhtphhouhhtnecuvehluhhsth
gvrhfuihiivgeptd

X-me-spamlevel: not-spam

X-ME-Helo: smtp1.tech.numericable.fr

X-ME-IP: 82.216.111.37

X-ME-Entity: ofr

Received: from mowmail-nc4.nc.sdv.fr (mowmail-nc4.tech.numericable.fr [82.216.111.104])
by smtp1.tech.numericable.fr (Postfix) with SMTP id AE4F8146C45;
Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

Received: from [37.120.143.12] by webmail.numericable.fr with http webmail;
Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

X-EA-Auth: +dMdE6okMTKk+o7IC5Yttwd+CsMDqA0r8RwRuLiz7FmNZa9L2lb1mOZ8KfZ
fMqPSIJfSbKDR3lw=

From: "Brigitte GASNIER"

To: sellig94@noos.fr

Date: Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

Subject: tr: BULLETIN DE PAIE -

X-Priority: 3

MIME-Version: 1.0

X-Mailer: COMS/EA14.11/r20171018

Message-ID:

Content-Type: multipart/mixed;
boundary="----=_NextPart_000_5d0fc096_b660_4fcf1701"

X-VR-SPAMSTATE: OK

X-VR-SPAMSCORE: 15

X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddruddtgdduvdeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecupfgfoffgtffkveetuefngfdpqfgfvfenuceurg
hilhhouhhtmecufedttdenucgoteeftdduqddtudculdduhedmnecujfgurhephffvfffurfggoffktgesmhdttderredtjeenucfhrhhomhepfdeurhhighhithhtvgcu
ifetuffpkffgtfdfuceoshgvlhhlihhgleegsehnohhoshdrfhhrqeenucfkphepfeejrdduvddtrddugeefrdduvdenucfrrghrrghmpehmohguvgepshhmthhpohhuth
enucevlhhushhtvghrufhiiigvpedt
pièce(s) jointe(s) 1 fichier(s)

OIUP159.png
(265.16 ko)
télécharger
voir
fermer détails

ajouter au Cloud

Madame/Monsieur,

Nous avons le plaisir de vous informer que grâce à votre émail, vous êtes bénéficiaire à MEGA-MILLION sis à WASHINGTON.

Ce qui signifie que vous empochez la somme de SIX CENT CINQUANTE mille € à la deuxième place lors du tirage .Après prise de connaissance des fichiers joints, prière de prendre contacte avec le responsable accrédité en lui fournissant vos informations demandées par notre Direction

Cordialement.
rigitte GASNIER"
ajouter à mes contacts
créer une alerte SMS
à sellig94@noos.fr
date 23/06/19 20:16
objet tr: BULLETIN DE PAIE -
fermer l'en-tête

Return-Path:

Received: from mwinf5c22 (mwinf5c22 [10.223.111.72])
by mwinb2c04 with LMTPA;
Sun, 23 Jun 2019 20:16:19 +0200

X-Sieve: CMU Sieve 2.3

Received: from smtp1.tech.numericable.fr ([82.216.111.37])
by mwinf5c22 with ME
id UJFj2001j0oToaS01JFk7F; Sun, 23 Jun 2019 20:16:19 +0200

X-bcc: gc.cam@wanadoo.fr

X-ME-bounce-domain: wanadoo.fr

X-ME-engine: default

X-me-spamcause: (-308)(0000)gggruggvucftvghtrhhoucdtuddrgeduvddruddtgdduvdekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrih
hlohhuthemucegtddtnecundfqrhgrnhhgvgeurggutfgvphhuthfkphculddqfedtkedmnecujfgurhephffvfffurfggoffktgesmhdttderredtjeenucfhrhhomhep
fdeurhhighhithhtvgcuifetuffpkffgtfdfuceoshgvlhhlihhgleegsehnohhoshdrfhhrqeenucfkphepkedvrddvudeirdduuddurdefjedpfeejrdduvddtrdduge
efrdduvdenucfrrghrrghmpehhvghlohepshhmthhpuddrthgvtghhrdhnuhhmvghrihgtrggslhgvrdhfrhdpihhnvghtpeekvddrvdduiedrudduuddrfeejpdhmrghi
lhhfrhhomhepshgvlhhlihhgleegsehnohhoshdrfhhrpdhrtghpthhtohepghgtsghmseifrghnrgguohhordhfrhdpmhhouggvpehsmhhtphhouhhtnecuvehluhhsth
gvrhfuihiivgeptd

X-me-spamlevel: not-spam

X-ME-Helo: smtp1.tech.numericable.fr

X-ME-IP: 82.216.111.37

X-ME-Entity: ofr

Received: from mowmail-nc4.nc.sdv.fr (mowmail-nc4.tech.numericable.fr [82.216.111.104])
by smtp1.tech.numericable.fr (Postfix) with SMTP id AE4F8146C45;
Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

Received: from [37.120.143.12] by webmail.numericable.fr with http webmail;
Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

X-EA-Auth: +dMdE6okMTKk+o7IC5Yttwd+CsMDqA0r8RwRuLiz7FmNZa9L2lb1mOZ8KfZ
fMqPSIJfSbKDR3lw=

From: "Brigitte GASNIER"

To: sellig94@noos.fr

Date: Sun, 23 Jun 2019 20:10:30 +0200 (CEST)

Subject: tr: BULLETIN DE PAIE -

X-Priority: 3

MIME-Version: 1.0

X-Mailer: COMS/EA14.11/r20171018

Message-ID:

Content-Type: multipart/mixed;
boundary="----=_NextPart_000_5d0fc096_b660_4fcf1701"

X-VR-SPAMSTATE: OK

X-VR-SPAMSCORE: 15

X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddruddtgdduvdeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecupfgfoffgtffkveetuefngfdpqfgfvfenuceurg
hilhhouhhtmecufedttdenucgoteeftdduqddtudculdduhedmnecujfgurhephffvfffurfggoffktgesmhdttderredtjeenucfhrhhomhepfdeurhhighhithhtvgcu
ifetuffpkffgtfdfuceoshgvlhhlihhgleegsehnohhoshdrfhhrqeenucfkphepfeejrdduvddtrddugeefrdduvdenucfrrghrrghmpehmohguvgepshhmthhpohhuth
enucevlhhushhtvghrufhiiigvpedt
pièce(s) jointe(s) 1 fichier(s)

OIUP159.png
(265.16 ko)
télécharger
voir
fermer détails

ajouter au Cloud

Madame/Monsieur,

Nous avons le plaisir de vous informer que grâce à votre émail, vous êtes bénéficiaire à MEGA-MILLION sis à WASHINGTON.

Ce qui signifie que vous empochez la somme de SIX CENT CINQUANTE mille € à la deuxième place lors du tirage .Après prise de connaissance des fichiers joints, prière de prendre contacte avec le responsable accrédité en lui fournissant vos informations demandées par notre Direction

Cordialement.
Votre Commentaire / Vos Explicationstentative de phishing
Pour en Savoir +Comment signaler une arnaque de Phishing ?
Article: Qu'est-ce que le Phishing ?
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !

2 commentaires


  • Fraud Watcher/Advisor le 23/06/2019 à 22:32

    Arnaque confirmée à propos de l'utilisation et d'usurpation abusives d'identité non autorisée des marques de service, des logos et des noms commerciaux de Mega Millions®

    Les escroqueries de Mega Millions se présentent généralement sous la forme de fraudes payées à l’avance, qui impliquent un fraudeur qui contacte à tort des personnes prétendant qu’elles doivent payer une grosse somme d’argent.

    Sur cette page, vous trouverez les différents types d’escroqueries que les joueurs de loterie devraient connaître et des conseils pour les éviter. Il est important de noter qu'il n'est pas possible de gagner un prix pour une loterie que vous n'avez pas encore inscrite et les représentants de Mega Millions ne vous contacteront jamais au sujet d'un gain ou de frais avant que vous ne receviez vos gains.

    Comment identifier une arnaque de Mega Millions

    Les escroqueries de Mega Millions prennent différentes formes, mais voici quelques caractéristiques clés à surveiller:

    • Mauvaise qualité et grammaire incorrecte dans une lettre ou un courrier électronique. La lettre ou l'e-mail peut être adressé à "détenteur de l'e-mail", "gagnant" ou "lecteur", plutôt que d'utiliser le nom de la victime.

    • Certaines escroqueries par courrier et par courrier électronique peuvent sembler authentiques, car les fraudeurs utilisent illégalement la marque Mega Millions pour convaincre leurs victimes.

    • La victime peut recevoir un faux chèque, qui peut être joint à un courrier électronique ou à une lettre, et le fraudeur peut prétendre qu'il s'agit d'une "taxe gouvernementale" ou de "frais".... Lire la suite

    Répondre
  • Fraud Watcher/Advisor le 23/06/2019 à 22:47

    A propos de l'envoi de cet email frauduleux :

    Pour des problèmes de piratage, de spam ou de sécurité, envoyer un mail à :

    abuse@gaoland.net

    auprès de votre fournisseur SFR SA / Numericable.

    Information related to 82.216.0.0 - 82.216.255.255

    Abuse contact for 82.216.0.0 - 82.216.255.255 is abuse@gaoland.net

    inetnum: 82.216.0.0 - 82.216.255.255
    netname: FR-SFR-20031022
    country: FR
    org: ORG-VF1-RIPE
    admin-c: LD699-RIPE
    tech-c: LDC76-RIPE
    status: ALLOCATED PA
    mnt-by: RIPE-NCC-HM-MNT
    mnt-by: SFR-MNT
    mnt-routes: SFR-MNT
    created: 2017-12-28T10:57:17Z
    last-modified: 2017-12-28T10:57:17Z
    source: RIPE

    organisation: ORG-VF1-RIPE
    org-name: SFR SA
    org-type: LIR
    remarks: xxxxxxxxxxxxxxxxxxxxxxx
    For Hacking, Spamming or Security problems send mail to :
    abuse@gaoland.net
    remarks: xxxxxxxxxxxxxxxxxxxxxx
    address: Campus SFR 12 rue Jean-Philippe Rameau - CS 80001
    address: 93634
    address: La-Plaine-Saint-Denis Cedex
    address: FRANCE
    phone: +33 1 70 18 52 00
    fax-no: +33 1 70 18 11 61
    abuse-c: AR15368-RIPE
    admin-c: RB14609-RIPE
    admin-c: LD699-RIPE
    mnt-ref: RIPE-NCC-HM-MNT
    mnt-ref: SFR-MNT
    mnt-by: RIPE-NCC-HM-MNT
    mnt-by: SFR-MNT
    created: 2004-04-17T11:22:02Z
    last-modified: 2018-02-14T09:51:57Z
    source: RIPE # Filtered

    role: SFR Legal Contact
    address: Campus SFR
    address: 12 rue Jean-Philippe Rameau
    address: CS 80001
    address: 93634 La-Plaine-Saint-Denis Cedex
    address: France
    phone: +33 1 70 18 52 00
    admin-c: LDC76-RIPE
    admin-c: BEO13-RIPE
    tech-c: RB14609-RIPE
    tech-c: BEO13-RIPE
    nic-hdl: LD699-RIPE
    abuse-mailbox: abuse@gaoland.net
    mnt-by: LDCOM-MNT... Lire la suite

    Répondre
Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Italien Allemand Espagnol