Arnaque identité (Phishing) : creditmutuel@cmne.fr CREDIT MUTUEL

ARNAQUE SUSPECTÉE !!!

Date12/07/2019
Email frauduleuxcreditmutuel@cmne.fr
Pseudonyme utiliséCREDIT MUTUEL
Contenu de l'arnaqueCREDIT MUTUEL"
ajouter à mes contacts
créer une alerte SMS
à contact@gestion-systemes.fr
date 11/07/19 14:45
objet *** SPAM *** Nouvelle demande d'adhésion
fermer l'en-tête

Return-Path:

Received: from mwinf5c14 (mwinf5c14 [10.223.111.64])
by mwinb2c04 with LMTPA;
Thu, 11 Jul 2019 14:45:08 +0200

X-Sieve: CMU Sieve 2.3

Received: from mo502.mail-out.ovh.net ([217.182.1.67])
by mwinf5c14 with ME
id bQkp2002b1SkZqH01QkppF; Thu, 11 Jul 2019 14:45:08 +0200

X-bcc: gc.cam@wanadoo.fr

X-ME-bounce-domain: wanadoo.fr

X-ME-engine: default

X-me-spamcause: (300)(1000)gggruggvucftvghtrhhoucdtuddrgeduvddrgeekgdehhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhh
ouhhtmecugedttdenucfuphgrmhfkphgprhhtucdlfedttddmnecujfgurhephfhsvffufffkgggtofhtihesrhdtghepvddtudenucfhrhhomhepveftgfffkffvucfof
gfvfgfgnfcuoegtrhgvughithhmuhhtuhgvlhestghmnhgvrdhfrheqnecuffhomhgrihhnpehlihhnvgguihhnthhomhhinhgvrdgvuhdpmhhitghrohhsohhfthdrtgh
omhenucfkphepvddujedrudekvddruddrieejpdehuddrjeejrddutdekrddvudehnecurfgrrhgrmhephhgvlhhopehmohehtddvrdhmrghilhdqohhuthdrohhvhhdrn
hgvthdpihhnvghtpedvudejrddukedvrddurdeijedpmhgrihhlfhhrohhmpegtohhnthgrtghtsehgvghsthhiohhnqdhshihsthgvmhgvshdrfhhrpdhrtghpthhtohe
pghgtrgihuhgvlhgrseifrghnrgguohhordhfrhenucevlhhushhtvghrufhiiigvpedt

X-me-spamlevel: med

X-ME-Helo: mo502.mail-out.ovh.net

X-ME-IP: 217.182.1.67

X-ME-Entity: ofr

Received: from mo66.mail-out.ovh.net (mo66.mail-out.ovh.net [178.32.228.66])
by mo502.mail-out.ovh.net (Postfix) with ESMTPS id 191B465179;
Thu, 11 Jul 2019 14:44:18 +0200 (CEST)

Received: from ex3.mail.ovh.net (unknown [10.109.160.230])
by mo66.mail-out.ovh.net (Postfix) with ESMTPS id CE73D1213DF;
Thu, 11 Jul 2019 14:44:13 +0200 (CEST)

Received: from WINPHQHG1PLEMJ (51.77.108.215) by DAG3EX2.indiv3.local
(172.16.2.6) with Microsoft SMTP Server (version=TLS1_2,
cipher=TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256) id 15.1.1591.10; Thu, 11 Jul
2019 14:44:12 +0200

From: CREDIT MUTUEL

Sender:

To:

Subject: *** SPAM *** =?iso-8859-1?Q?Nouvelle_demande_d'adh=E9sion?=

Date: Thu, 11 Jul 2019 05:44:06 -0700

Message-ID:

MIME-Version: 1.0

Content-Type: multipart/related;
boundary="----=_NextPart_000_01DA_01D537AB.AB5A8830"

X-Mailer: Microsoft Outlook 16.0

Thread-Index: AdU33imizjC+a8hRTSOkelGbaMniLw==

Content-Language: en-us

X-Originating-IP: [51.77.108.215]

X-ClientProxiedBy: CAS6.indiv3.local (172.16.1.6) To DAG3EX2.indiv3.local
(172.16.2.6)

X-Ovh-Tracer-Id: 3395714121792787742

X-VR-SPAMSTATE: OK

X-VR-SPAMSCORE: 0

X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddrgeekgdehjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfqggfjpdevjffgvefmvefgnecuuegrihhlohhuth
emucehtddtnecu

X-VR-SPAMSTATE: OK

X-VR-SPAMSCORE: 0

X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddrgeekgdehjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfqggfjpdevjffgvefmvefgnecuuegrihhlohhuth
emucehtddtnecu
Une image contenant capture d’écranDescription générée automatiquement

Une image contenant capture d’écranDescription générée automatiquement

marquer comme non lu
Aide et contactForum d'entraideTrouver une boutique
Commentaire / Explicationsphishing plus usurpation d'identité de Crédit Mutuel. Pas client de cette banque
Pour en Savoir +Comment signaler une arnaque de Phishing ?
Article: Qu'est-ce que le Phishing ?
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !

4 commentaires


  • Pakonue le 12/07/2019 à 08:37

    Signalez ce phishing à https://www.signal-spam.fr/

    Répondre
  • Fraud Watcher/Advisor le 12/10/2019 à 21:45

    Ce mail est effectivement une tentative de phishing. Il n'est pas émis par votre banque. Merci de nous l'avoir signalé.

    Veuillez ne pas en tenir compte et ne pas y répondre.

    Nous mettons tout en oeuvre pour faire clôturer ce site au plus vite.

    Nous vous rappelons de ne jamais fournir vos mots de passe ou plusieurs clés de votre carte de clés personnelles.

    Aucun organisme n'est censé vous demander ces informations.

    Pour plus de sécurité, vous avez la possibilité d'installer notre barre de confiance. Sur notre site internet, rendez-vous dans la rubrique "Sécurité" où vous trouverez toutes les informations nécessaires.

    Si vous pensez être victime d'une fraude bancaire, que vous avez communiqué votre carte de clés personnelles et/ou vos identifiants, contactez immédiatement votre conseiller bancaire avec lequel vous déciderez de la meilleure marche à suivre en fonction de votre situation.... Lire la suite

    Répondre
  • Fraud Watcher/Advisor le 12/10/2019 à 22:05

    A propos de cette adresse IP address 217.182.1.67 qui confirme l’origine de sa provenance via ce serveur / hébergeur / fournisseur d’accès internet et de leur datacenter de OVH SAS :

    Signalement d'abus et de contenus illicites via en ligne sur le(ur) site internet https://www.ovh.com/fr/abuse/

    ou par email :

    abuse@ovh.net

    Information related to 217.182.1.0 - 217.182.1.255

    Abuse contact for 217.182.1.0 - 217.182.1.255 is abuse@ovh.net

    inetnum: 217.182.1.0 - 217.182.1.255
    netname: OVH_MAILOUT
    country: FR(ANCE)
    descr: Email servers
    org: ORG-OS3-RIPE
    admin-c: OTC2-RIPE
    tech-c: OTC2-RIPE
    status: ASSIGNED PA
    mnt-by: OVH-MNT
    created: 2017-02-20T14:36:10Z
    last-modified: 2017-02-20T14:36:10Z
    source: RIPE

    organisation: ORG-OS3-RIPE
    org-name: OVH SAS
    org-type: LIR

    OVH SAS... Lire la suite

    Répondre
  • Fraud Watcher/Advisor le 13/10/2019 à 20:25

    Les fraudeurs sur internet redoublent d’imagination pour présenter des pièges toujours plus sophistiqués afin de recueillir vos coordonnées bancaires.

    Le phishing

    Par cette technique, les pirates imitent des messages ou des sites institutionnels pour recueillir vos informations confidentielles.

    Dans la plupart des cas, cette escroquerie est réalisée par le biais de faux e-mails de banque ou d’organisme officiel. Ces messages prétextent une mise à jour technique du portail de la banque ou une prétendue vérification de vos coordonnées personnelles. En cliquant sur un lien contenu dans le message, vous êtes alors redirigé vers un site imitant le site institutionnel de la banque puis invité à saisir vos identifiants et mots de passe.... Lire la suite

    Répondre
Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Italien Allemand Espagnol