Arnaque identité (Phishing) : creditmutuel@cmne.fr CREDIT MUTUEL

ARNAQUE SUSPECTÉE !!!

Date12/07/2019
Email frauduleuxcreditmutuel@cmne.fr
Pseudonyme utiliséCREDIT MUTUEL
Contenu de l'arnaqueCREDIT MUTUEL"
ajouter à mes contacts
créer une alerte SMS
à contact@gestion-systemes.fr
date 11/07/19 14:45
objet *** SPAM *** Nouvelle demande d'adhésion
fermer l'en-tête

Return-Path:

Received: from mwinf5c14 (mwinf5c14 [10.223.111.64])
by mwinb2c04 with LMTPA;
Thu, 11 Jul 2019 14:45:08 +0200

X-Sieve: CMU Sieve 2.3

Received: from mo502.mail-out.ovh.net ([217.182.1.67])
by mwinf5c14 with ME
id bQkp2002b1SkZqH01QkppF; Thu, 11 Jul 2019 14:45:08 +0200

X-bcc: gc.cam@wanadoo.fr

X-ME-bounce-domain: wanadoo.fr

X-ME-engine: default

X-me-spamcause: (300)(1000)gggruggvucftvghtrhhoucdtuddrgeduvddrgeekgdehhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhh
ouhhtmecugedttdenucfuphgrmhfkphgprhhtucdlfedttddmnecujfgurhephfhsvffufffkgggtofhtihesrhdtghepvddtudenucfhrhhomhepveftgfffkffvucfof
gfvfgfgnfcuoegtrhgvughithhmuhhtuhgvlhestghmnhgvrdhfrheqnecuffhomhgrihhnpehlihhnvgguihhnthhomhhinhgvrdgvuhdpmhhitghrohhsohhfthdrtgh
omhenucfkphepvddujedrudekvddruddrieejpdehuddrjeejrddutdekrddvudehnecurfgrrhgrmhephhgvlhhopehmohehtddvrdhmrghilhdqohhuthdrohhvhhdrn
hgvthdpihhnvghtpedvudejrddukedvrddurdeijedpmhgrihhlfhhrohhmpegtohhnthgrtghtsehgvghsthhiohhnqdhshihsthgvmhgvshdrfhhrpdhrtghpthhtohe
pghgtrgihuhgvlhgrseifrghnrgguohhordhfrhenucevlhhushhtvghrufhiiigvpedt

X-me-spamlevel: med

X-ME-Helo: mo502.mail-out.ovh.net

X-ME-IP: 217.182.1.67

X-ME-Entity: ofr

Received: from mo66.mail-out.ovh.net (mo66.mail-out.ovh.net [178.32.228.66])
by mo502.mail-out.ovh.net (Postfix) with ESMTPS id 191B465179;
Thu, 11 Jul 2019 14:44:18 +0200 (CEST)

Received: from ex3.mail.ovh.net (unknown [10.109.160.230])
by mo66.mail-out.ovh.net (Postfix) with ESMTPS id CE73D1213DF;
Thu, 11 Jul 2019 14:44:13 +0200 (CEST)

Received: from WINPHQHG1PLEMJ (51.77.108.215) by DAG3EX2.indiv3.local
(172.16.2.6) with Microsoft SMTP Server (version=TLS1_2,
cipher=TLS_ECDHE_RSA_WITH_AES_128_GCM_SHA256) id 15.1.1591.10; Thu, 11 Jul
2019 14:44:12 +0200

From: CREDIT MUTUEL

Sender:

To:

Subject: *** SPAM *** =?iso-8859-1?Q?Nouvelle_demande_d'adh=E9sion?=

Date: Thu, 11 Jul 2019 05:44:06 -0700

Message-ID:

MIME-Version: 1.0

Content-Type: multipart/related;
boundary="----=_NextPart_000_01DA_01D537AB.AB5A8830"

X-Mailer: Microsoft Outlook 16.0

Thread-Index: AdU33imizjC+a8hRTSOkelGbaMniLw==

Content-Language: en-us

X-Originating-IP: [51.77.108.215]

X-ClientProxiedBy: CAS6.indiv3.local (172.16.1.6) To DAG3EX2.indiv3.local
(172.16.2.6)

X-Ovh-Tracer-Id: 3395714121792787742

X-VR-SPAMSTATE: OK

X-VR-SPAMSCORE: 0

X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddrgeekgdehjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfqggfjpdevjffgvefmvefgnecuuegrihhlohhuth
emucehtddtnecu

X-VR-SPAMSTATE: OK

X-VR-SPAMSCORE: 0

X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddrgeekgdehjecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfqggfjpdevjffgvefmvefgnecuuegrihhlohhuth
emucehtddtnecu
Une image contenant capture d’écranDescription générée automatiquement

Une image contenant capture d’écranDescription générée automatiquement

marquer comme non lu
Aide et contactForum d'entraideTrouver une boutique
Votre Commentaire / Vos Explicationsphishing plus usurpation d'identité de Crédit Mutuel. Pas client de cette banque
Pour en Savoir +Comment signaler une arnaque de Phishing ?
Article: Qu'est-ce que le Phishing ?
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !

1 commentaire


Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Italien Allemand Espagnol