Arnaque de loterie : Patrice BARRAU | Me Jean Pierre HORY


Pseudonyme utiliséPatrice BARRAU | Me Jean Pierre HORY
Contenu de l'arnaqueDe : Patrice BARRAU []
Envoyé : dimanche 21 juillet 2019 03:37
À :

Pièces jointes d’un fichier WIN-WIN.png (194 Ko)

Chère cliente, cher client,
Nous vous informons que vous venεz dε gagner 65 0 0 0 0 EUR au jeu MEGALOTTO2019
Pour plus d'informations consultεz les pièces jointes.
Pour la marchε à suivrε contactεz Me Hory par émaiL;
Vous trouvεrεz son adrεsse dans les fichiεrs.
Bonne réception


Voici le contenu de la pièce jointe WIN-WIN.png (194 Ko) :


Nous avons le plaisir de vous informer du tirage au sort du programme spécial MY MILLIONS By MEGA MILLIONS. Votre adresse électronique attachée à un Nombre de série : CPTNB/3615/19 a tiré les Nombres Gagnants : 7 - 18 - 29 - 32 - 17 - 45, qui vous ont par la suite permis de partager la cagnotte de 30 millions d’euros en jeu.

Vous avez donc, été tiré au sort pour bénéficier de la somme de € 650.000 (SIX CENT CINQUANTE MILLE EURO) net d’impôt, crédité au fichier CPTNB/591-5776/19.

Tous les participants ont été choisis de façon aléatoire sur Internet grâce à un système informatique de tirage au sort regroupant une base de données d’adresse reçu de tous nos partenaires. Vous êtes donc inscrit sur l’un des sites internet de l’un d’entre eux. Cette promotion a lieu annuellement. Pour des raisons de sécurité, nous vous conseillons de tenir vos informations d’identification confidentielles jusqu’à ce que votre dossier soit traité par le bureau de réclamation et votre gain transféré selon le mode préférentiel que vous aurez choisi.
Il s’agit tout simplement d’une mesure de précaution pour éviter les cas de double réclamation de gain et l’usage abusif de ce programme.

Veuillez envoyer vos coordonnées suivants à l’adresse E-mail du Superviseur de la loterie (Maître Jean Pierre Hory), chargé de vous indiquer procédure de remise de votre gain.

Prénom, Nom, Ville, Code Posta, Pays, Numéro de Mobile et Fixe, Professsion


Envoyez à

Adresse E-mail :


Conformément à l’article 34 de la Loi Informatique et Libertés n° 78-17 du 6 janvier 1978, vous disposez d’un droit d’accès, de modification, de rectification et de suppression des données qui vous concernent après le transfert de votre gain, vous pouvez l’exercer en adressant un courrier postal à notre siège social. »

En-têtes Internet / source du message :


status: ACTIVE
hold: NO
holder-c: N3054-FRNIC
admin-c: SP13644-FRNIC
tech-c: SASP1-FRNIC
tech-c: SG1540-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL6956-FRNIC
Expiry Date: 2019-12-27T14:25:57Z
created: 1999-12-12T23:00:00Z
last-update: 2018-12-27T14:34:36Z
source: FRNIC

ns-list: NSL6956-FRNIC
source: FRNIC


SdV Plurimédia - Pionnier de l'industrie digitale, SdV accompagne le développement Web de marques prestigieuses - Hébergement, infogérance, consultant en informatique à Strasbourg...

type: Isp Option 1
address: 15 Rue de la Nuée Bleue
address: 67000 STRASBOURG
country: FR(ANCE)
phone: 03 88 75 80 50
fax-no: 03 88 23 56 32
anonymous: NO
registered: 2000-07-03T12:00:00Z
source: FRNIC

nic-hdl: N3054-FRNIC

10, rue Albert Einstein
77437 Marne la Vallee, France
Tél : 01 77 46 81 26
Email :
Site web : Erreur liée à la sécurité
Le site que vous allez ouvrir contient des logiciels malveillants. Des individus malveillants à l’œuvre sur le site pourraient tenter d’installer des programmes dangereux sur votre ordinateur afin de récupérer ou de supprimer certaines informations (photos, mots de passe, messages ou numéros de carte de crédit, par exemple).

changed: 2015-08-03T12:32:31Z
anonymous: NO
obsoleted: NO
eligstatus: ok
eligsource: REGISTRAR
eligdate: 2012-06-14T15:08:54Z
reachstatus: not identified
source: FRNIC

nic-hdl: SP13644-FRNIC

15, rue de la nuée bleue
67000 Strasbourg, France
Tél : 03 88 75 80 50
Fax : 03 3 88 23 56 32
Email :

changed: 2015-02-10T13:49:59Z
anonymous: NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: SASP1-FRNIC
type: ROLE
contact: Service-AFNIC SdV-Plurimedia

15, rue de la Nuee Bleue
67000 Strasbourg, France

admin-c: ML4155-FRNIC
tech-c: SG727-FRNIC
changed: 2008-10-17T08:07:58Z
anonymous: NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: SG1540-FRNIC
type: ROLE

Salim Gasmi
15, rue de la Nuee Bleue
67000 Strasbourg, France
Tél : 03 88 75 80 50

admin-c: ML654-FRNIC
admin-c: ML1130-FRNIC
tech-c: SASP1-FRNIC
tech-c: SG727-FRNIC
changed: 2008-10-16T15:58:31Z

Received: from mwinf5c43 (mwinf5c43 [])

Whois IP

OrgAbuseHandle: IANA-IP-ARIN
OrgAbuseName: ICANN
OrgAbusePhone: +1-310-301-5820

by mwinb2z06 with LMTPA;
Sun, 21 Jul 2019 03:36:39 +0200
X-Sieve: CMU Sieve 2.3
Received: from ([])

Whois IP

Information related to -

Abuse contact for - is

inetnum: -
netname: FR-SFR-20031022
country: FR(ANCE)
admin-c: LD699-RIPE
tech-c: LDC76-RIPE
mnt-by: SFR-MNT
mnt-routes: SFR-MNT
created: 2017-12-28T10:57:17Z
last-modified: 2017-12-28T10:57:17Z
source: RIPE

organisation: ORG-VF1-RIPE
org-name: SFR SA
org-type: LIR
For Hacking, Spamming or Security problems send mail to: | Pour les problèmes de piratage, de spam ou de sécurité, envoyez un courrier à :
address: Campus SFR 12 rue Jean-Philippe Rameau - CS 80001
address: 93634
address: La-Plaine-Saint-Denis Cedex
address: FRANCE
phone: +33 1 70 18 52 00
fax-no: +33 1 70 18 11 61
abuse-c: AR15368-RIPE
admin-c: RB14609-RIPE
admin-c: LD699-RIPE
mnt-ref: RIPE-NCC-HM-MNT
mnt-ref: SFR-MNT
mnt-by: SFR-MNT
created: 2004-04-17T11:22:02Z
last-modified: 2018-02-14T09:51:57Z
source: RIPE # Filtered

role: SFR Legal Contact

Campus SFR
12 rue Jean-Philippe Rameau
CS 80001
93634 La-Plaine-Saint-Denis Cedex, France
Tél : 01 70 18 52 00

admin-c: LDC76-RIPE
admin-c: BEO13-RIPE
tech-c: RB14609-RIPE
tech-c: BEO13-RIPE
nic-hdl: LD699-RIPE
mnt-by: LDCOM-MNT
created: 2003-10-23T09:15:54Z
last-modified: 2017-09-05T09:03:05Z
source: RIPE # Filtered

role: LDCOM Networks Tech Contact

12 rue Jean-Philippe Rameau
CS 80001
93634 La Plaine Saint-Denis Cedex, France
Tél : 01 70 18 52 00

admin-c: LD699-RIPE
admin-c: LM5867-RIPE
admin-c: BEO13-RIPE
tech-c: DG1056-RIPE
nic-hdl: LDC76-RIPE
mnt-by: LDCOM-MNT
created: 2001-12-20T14:34:14Z
last-modified: 2016-12-14T09:33:06Z
source: RIPE # Filtered

Information related to

origin: AS21502
created: 2007-03-02T14:25:13Z
last-modified: 2008-06-18T15:01:30Z
source: RIPE |

Domain Information

Registrar: SafeBrands SAS
Registered On: 2000-08-07
Expires On: 2019-08-07
Updated On: 2019-06-22
Status: clientTransferProhibited
Name Servers: |

Registrant / Administrative Contacts

Name: CHAMARD Claire
1 Square Bela Bartok
75015 PARIS, France
Tél :01 71 08 08 65
Email :

Technical Contact

Name: Host Master
Organization: SafeBrands
Pôle Media de la Belle de Mai
37 rue Guibal
13356 Marseille cedex 03, France
Tél : 04 88 66 22 22
Fax: 04 88 66 22 20
Email :

Raw Whois Data
Domain Name:
Registrar WHOIS Server:
Registrar URL:
Updated Date: Jun 22 2019 05:02:00:000AM
Creation Date: 2000-08-07T14:33:07+02:00
Registrar Registration Expiration Date: 2019-08-07T14:33:07+02:00
Registrar: Safebrands SAS
Registrar IANA ID: 1290

Registrar Abuse Contact Email:
Registrar Abuse Contact Phone: +33.488662222

Conformément aux dispositions de la loi informatique et libertés n ° 78-17 du 6 janvier 1978, vous disposez d'un droit d'accès, de rectification et de suppression des données personnelles que SafeBrands collecte auprès de vous. Vous pouvez obtenir plus d' informations sur ce sujet en se connectant au site . Vos données personnelles sont collectées par nous dans le seul but de vous contacter conformément à la demande formulée. Vous pouvez nous contacter pour exercer ce droit, avec une copie de votre ID en pièce jointe, en écrivant par courrier électronique à l'adresse suivante:

by mwinf5c43 with ME
id fDcc2000a0uwAFm01Dcdr4; Sun, 21 Jul 2019 03:36:39 +0200
X-ME-engine: default
X-me-spamcause: (15)(0000)gggruggvucftvghtrhhoucdtuddrgeduvddrjedtgdegkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecugedttdenucgoteeftdduqddtudculdduhedmnecujfgurhephffvfffurfggoffkpfgtsehmtddtreertdejnecuhfhrohhmpedfrfgrthhrihgtvgcuueettffttegffdcuoehprghtrhhitggvrdgsrghrrhgruhesnhhoohhsrdhfrheqnecukfhppeekvddrvdduiedrudduuddrgedvpdefjedruddvtddrudegfedrgeenucfrrghrrghmpehhvghlohepshhmthhpiedrthgvtghhrdhnuhhmvghrihgtrggslhgvrdhfrhdpihhnvghtpeekvddrvdduiedrudduuddrgedvpdhmrghilhhfrhhomhepphgrthhrihgtvgdrsggrrhhrrghusehnohhoshdrfhhrpdhrtghpthhtohepphhhihhlihhpphgvrdhgrghsqhhuvghrvghssehorhgrnhhgvgdrfhhrpdhmohguvgepshhmthhpohhuthenucevlhhushhtvghrufhiiigvpedu
X-me-spamlevel: not-spam
X-ME-Entity: ofr
Received: from ( [])

Whois IP

For Hacking, Spamming or Security problems send mail to: | Pour les problèmes de piratage, de spam ou de sécurité, envoyez un courrier à :

by (Postfix) with SMTP id 798A11834D8;
Sun, 21 Jul 2019 03:36:36 +0200 (CEST)
Received: from [] by with http webmail;

Whois IP

Information related to -

Abuse contact for - is

inetnum: -
netname: M247-LTD-Brussels

M247 Ltd , Metronet UK Ltd et Venus Business Communications Ltd, exerçant sous le nom de M247. Enregistré en Angleterre et au Pays de Galles. Numéros enregistrés: 04968341, 04975343 & 04800517 Siège social: Turing House, Archway 5, Manchester M15 5RL

descr: M247 LTD Brussels Infrastructure
country: BE(LGIQUE)
geoloc: 50.8333 4.3333
admin-c: GBN16-RIPE
tech-c: GBN16-RIPE
mnt-by: SDAT-MNT
mnt-by: M247-EU-MNT
mnt-routes: GLOBALAXS-MNT
mnt-domains: GLOBALAXS-MNT
remarks:---- LEGAL CONCERNS ----
For any legal requests, please send an email to for a maximum 48hours response.

Pour toute demande légale, merci d'envoyer un email à pour une réponse maximum de 48 heures.

remarks:---- LEGAL CONCERNS ----
created: 2018-10-16T07:39:04Z
last-modified: 2018-12-30T14:26:45Z
source: RIPE

role: M247 Brussels NOC
address: Wezembeekstraat 2
address: 1930, Zaventem, Belgium
nic-hdl: GBN16-RIPE
created: 2016-03-03T08:32:09Z
last-modified: 2018-05-17T12:56:30Z
source: RIPE # Filtered

Interxion Belgium NV
Wezembeekstraat 2 bus 1
1930 Zaventem
T: +32 2 709 03 60
F: +32 2 725 76 23

remarks: M247 - Network Management Centre
address: 1 Ball Green, Cobra Court
address: M32 0QT, Manchester - United Kingdom
tech-c: JB3482-RIPE
tech-c: CB2407-RIPE
nic-hdl: GBXS-RIPE
created: 2006-07-13T15:37:05Z
last-modified: 2018-09-10T17:32:45Z
source: RIPE # Filtered

Information related to

origin: AS9009
created: 2018-10-16T14:24:54Z
last-modified: 2018-10-16T14:24:54Z
source: RIPE

GlobalAXS Communications is a provider of high capacity connectivity services in London, Manchester, Amsterdam, Frankfurt, Prague, Milan, Paris and Brussels.
Inscrit en mai 2011

Sun, 21 Jul 2019 03:36:36 +0200 (CEST)
X-EA-Auth: j3FzwElrvBNXq6fkjtp35cDsmczJ5tdZ56bMwS68PsyMxYh2VcPtbhbsVQ3
From: "Patrice BARRAU"
Date: Sun, 21 Jul 2019 03:36:36 +0200 (CEST)
Subject: tr: INFORMATION
X-Priority: 3
MIME-Version: 1.0
X-Mailer: COMS/EA14.11/r20171018
Content-Type: multipart/mixed;
X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddrjedtgdegkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfpfgfogfftkfevteeunffgpdfqfgfvnecuuegrihhlohhuthemuceftddtnecuogetfedtuddqtdduucdludehmdenucfjughrpefhvfffuffrggfokffptgesmhdttderredtjeenucfhrhhomhepfdfrrghtrhhitggvuceutefttfetfgdfuceophgrthhrihgtvgdrsggrrhhrrghusehnohhoshdrfhhrqeenucfkphepfeejrdduvddtrddugeefrdegnecurfgrrhgrmhepmhhouggvpehsmhhtphhouhhtnecuvehluhhsthgvrhfuihiivgepud

Il y a des millions de serveurs Internet piratés chaque jour de la même main, remplis de pirates informatiques.

Tous les webmasters ont les mêmes problèmes avec les pirates informatiques, les intrus, les attaquants et les spammeurs, mais personne ne se bat contre ces terroristes.

Non, nous luttons contre les pirates, les intrus, les attaquants, les spammeurs, les cyber-terroristes et le !

Received and posted by Fraud Watcher/Advisor
Commentaire / ExplicationsPas concerné par l’objet de cet envoi de ce message.

Probabilité d'utilisation et d'usurpation abusives d'adresses emails légitimes de ces personnes victimes à leur insu (dans certains cas) souvent utilisées comme émetteur de l'envoi supposé pour passer entre les mailles du filet (filtres) d'un logiciel quelconque qui ne détecte pas la présence d'un SPAM ou d'un courrier indésirable.

L’adresse email de l’émetteur est la même pour le destinataire :

« De : Patrice BARRAU []
Envoyé : dimanche 21 juillet 2019 03:37
À :
Objet : tr: INFORMATION »

Sauf que mon adresse courriel est masquée toujours par la sienne et ses semblables.

« Chère cliente, cher client, » n’est pas approprié pour annoncer que vous avez gagné à la loterie alors que je suis bien placé pour le savoir que je n’ai (jamais) participé à ce jeu du hasard quelconque et encore moins « un client » comme il le prétend.

Sachant qu’il n’a pas la présence physique d’un vrai virus informatique dans ce fichier joint car sinon, il n’y a aucun intérêt pour lui (l’escroc) et ses victimes d'empêcher de lire son contenu «WIN-WIN.png » avec son adresse email de l’escroc visible sur le faux document joint.

Jusqu’à présent, je n’ai jamais reçu ce type d’arnaque de ce genre sauf pour commenter les autres qu’ils ont déjà reçus et signaler sur ce site.

« Nous avons le plaisir de vous informer du tirage au sort du programme spécial MY MILLIONS By MEGA MILLIONS. Votre adresse électronique attachée à un Nombre de série : CPTNB/3615/19 a tiré les Nombres Gagnants : 7 - 18 - 29 - 32 - 17 - 45, qui vous ont par la suite permis de partager la cagnotte de 30 millions d’euros en jeu »

Cet escroc ignore (ou le sait mieux que moi) que ce MEGA MILLIONS se joue uniquement aux USA et le montant de la cagnotte est toujours en US Dollar$ et jamais en €uros.
Piece(s) jointe(s)
Autres Références (3 commentaires) (2 commentaires) (2 commentaires) (2 commentaires)
Pour en Savoir +Numéro de téléphone dangereux détecté dans ce signalement d'arnaque: Lisez cet article.
Arnaques de loteries: Comprenez leur fonctionnement !
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !

4 commentaires

  • Fraud Watcher/Advisor le 21/07/2019 à 22:01

    Arnaque confirmée à propos de l'utilisation et d'usurpation abusives d'identité non autorisée des marques déposées ou de service, des logos (Powerball®/ Mega Millions® /®) et des noms commerciaux de Mega Millions®

    Chez, nous prenons votre sécurité et vos rapports de fraude très au sérieux. Des cas d'arnaqueurs de loterie pouvant prétendre être des employés d'un conseil de loterie ou de ont été rapportés. Ils peuvent utiliser les logos de loterie réels (Powerball ou Mega Millions) et les logos de société

    Évitez d'être victime d'une arnaque en prenant conscience de ce qui suit :

    • Les employés de ne vous demanderont JAMAIS de l'argent.

    • N'envoyez jamais d'argent à un destinataire inconnu. Cela inclut les chèques, les mandats, les cartes prépayées, les virements électroniques ou tout autre type de paiement.... Lire la suite

  • Fraud Watcher/Advisor le 21/07/2019 à 22:35

    Vous recevez un appel ou une lettre vous informant que vous pouvez gagner des millions dans une loterie étrangère. Est-ce votre jour de chance ? C'est probablement une arnaque qui profite de votre enthousiasme pour réclamer un gros prix.

    • Les escrocs profitent de notre désir naturel de gagner. Vous voyez des loteries d'État et autres concours annoncés tout le temps. Pourquoi ne serait-ce pas votre tour de gagner ? Ainsi, lorsque quelqu'un présente la possibilité de jouer à une loterie étrangère, cela peut sembler être l'occasion idéale.

    • Il est illégal d'utiliser le courrier ou le téléphone pour jouer à des loteries transfrontalières. La loi américaine l'interdit, non seulement au-delà des frontières nationales, mais aussi entre les frontières des États. Vous pourriez donc être accusé d'activités illégales simplement en participant.... Lire la suite

  • Fraud Watcher/Advisor le 17/11/2019 à 21:57

    Pour les problèmes de piratage informatique, d'abus frauduleux, de spam ou de sécurité, veuillez signaler et transférez nous cet email en l'état grâce au bouton "transfert" de votre messagerie à ces 4 adresses mails suivantes :

    SFR | RED by SFR | SFR Group | SFR Business | CEGETEL | Neuf Telecom | Numericable | Groupe ALTICE France

    Adresse physique :

    10, rue Albert Einstein

    Adresse postale :
    77437 MARNE LA VALLEE Cedex 2
    Tél : 01 77 46 81 26 | 01 70 01 49 41
    Fax : 01 70 00 70 09 | 01 70 01 40 54
    Site web:

    Site web : (*)

    (*) Interdit‎ - ‎Vous n'avez pas la permission d'accéder / sur ce serveur.‎... Lire la suite

  • Fraud Watcher/Advisor le 18/11/2019 à 02:56

    Arnaque confirmée à propos d’une escroquerie de la (fausse) loterie (bidon) en provenance de la République de Côte d’Ivoire (RCI) et similaire au(x) vôtre(s) parmi tant d’autres déjà signalée sur ce site pour info à ce sujet :

    Il ‎‎n'y‎‎ a pas de résultats officiels ou significatifs pour cette personne ciblée au sujet d'un soi disant " Maître Jean Pierre HORY "‎ dans notre banque de données professionnelles associées à son nom et avec ces fausses adresses emails déclarées frauduleuses :



    Nous vous recommandons de ne pas y répondre et de ne pas ouvrir les pièces qui y sont jointes.

    N’envoyer aucune information personnelle vous concernant et faites un signalement sur Lire la suite

Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Italien Allemand Espagnol