Arnaque de loterie : patrice.barrau@noos.fr Patrice BARRAU | Me Jean Pierre HORY

ARNAQUE SUSPECTÉE !!!

Date21/07/2019
Email frauduleuxpatrice.barrau@noos.fr
Pseudonyme utiliséPatrice BARRAU | Me Jean Pierre HORY
Contenu de l'arnaqueDe : Patrice BARRAU [mailto:patrice.barrau@noos.fr]
jphjphory@gmail.com
ea-mime-5d33c1a4-1005-534b219a@webmail.numericable.fr
Envoyé : dimanche 21 juillet 2019 03:37
À : patrice.barrau@noos.fr
Objet : tr: INFORMATION

Pièces jointes d’un fichier WIN-WIN.png (194 Ko)

Chère cliente, cher client,
Nous vous informons que vous venεz dε gagner 65 0 0 0 0 EUR au jeu MEGALOTTO2019
Pour plus d'informations consultεz les pièces jointes.
Pour la marchε à suivrε contactεz Me Hory par émaiL;
Vous trouvεrεz son adrεsse dans les fichiεrs.
Bonne réception

---------------------

Voici le contenu de la pièce jointe WIN-WIN.png (194 Ko) :

« MEGA MILLIONS
AVIS DE GAIN

Nous avons le plaisir de vous informer du tirage au sort du programme spécial MY MILLIONS By MEGA MILLIONS. Votre adresse électronique attachée à un Nombre de série : CPTNB/3615/19 a tiré les Nombres Gagnants : 7 - 18 - 29 - 32 - 17 - 45, qui vous ont par la suite permis de partager la cagnotte de 30 millions d’euros en jeu.

Vous avez donc, été tiré au sort pour bénéficier de la somme de € 650.000 (SIX CENT CINQUANTE MILLE EURO) net d’impôt, crédité au fichier CPTNB/591-5776/19.

Tous les participants ont été choisis de façon aléatoire sur Internet grâce à un système informatique de tirage au sort regroupant une base de données d’adresse reçu de tous nos partenaires. Vous êtes donc inscrit sur l’un des sites internet de l’un d’entre eux. Cette promotion a lieu annuellement. Pour des raisons de sécurité, nous vous conseillons de tenir vos informations d’identification confidentielles jusqu’à ce que votre dossier soit traité par le bureau de réclamation et votre gain transféré selon le mode préférentiel que vous aurez choisi.
Il s’agit tout simplement d’une mesure de précaution pour éviter les cas de double réclamation de gain et l’usage abusif de ce programme.

RECUPERATION DE GAIN
Veuillez envoyer vos coordonnées suivants à l’adresse E-mail du Superviseur de la loterie (Maître Jean Pierre Hory), chargé de vous indiquer procédure de remise de votre gain.

Prénom, Nom, Ville, Code Posta, Pays, Numéro de Mobile et Fixe, Professsion

WINNER

Envoyez à

Adresse E-mail :
jphjphory@gmail.com

SERVICE
RECLAMATION
DES GAINS

Conformément à l’article 34 de la Loi Informatique et Libertés n° 78-17 du 6 janvier 1978, vous disposez d’un droit d’accès, de modification, de rectification et de suppression des données qui vous concernent après le transfert de votre gain, vous pouvez l’exercer en adressant un courrier postal à notre siège social. »
------------------------

En-têtes Internet / source du message :

Return-Path: patrice.barrau@noos.fr

domain: noos.fr
status: ACTIVE
hold: NO
holder-c: N3054-FRNIC
admin-c: SP13644-FRNIC
tech-c: SASP1-FRNIC
tech-c: SG1540-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL6956-FRNIC
registrar: SDV PLURIMEDIA
Expiry Date: 2019-12-27T14:25:57Z
created: 1999-12-12T23:00:00Z
last-update: 2018-12-27T14:34:36Z
source: FRNIC

ns-list: NSL6956-FRNIC
nserver: ns1.numericable.fr
nserver: ns2.numericable.fr
source: FRNIC

registrar: SDV PLURIMEDIA

SdV Plurimédia - Pionnier de l'industrie digitale, SdV accompagne le développement Web de marques prestigieuses - Hébergement, infogérance, consultant en informatique à Strasbourg...

type: Isp Option 1
address: 15 Rue de la Nuée Bleue
address: 67000 STRASBOURG
country: FR(ANCE)
phone: +33 3 88 75 80 50
fax-no: +33 3 88 23 56 32
e-mail: domaines@sdv.fr
e-mail:rgpd@sdv.fr
website: https://www.sdv.fr/nos-services/sdv-agency/
https://www.sdv.fr/
anonymous: NO
registered: 2000-07-03T12:00:00Z
source: FRNIC

nic-hdl: N3054-FRNIC
type: ORGANIZATION
contact: NUMERICABLE
address: 10, rue Albert Einstein
address: 77437 Marne la Vallee
country: FR(ANCE)
phone: +33 1 77 46 81 26
e-mail: ingenierie.systeme@ncnumericable.com
https://signalement.fftelecoms.org/#sfrintid=FS_Signaler-un-contenu-illicite

http://numericable.com/ Erreur liée à la sécurité
Le site que vous allez ouvrir contient des logiciels malveillants. Des individus malveillants à l’œuvre sur le site http://numericable.com/ pourraient tenter d’installer des programmes dangereux sur votre ordinateur afin de récupérer ou de supprimer certaines informations (photos, mots de passe, messages ou numéros de carte de crédit, par exemple).

registrar: SDV PLURIMEDIA
changed: 2015-08-03T12:32:31Z nic@nic.fr
anonymous: NO
obsoleted: NO
eligstatus: ok
eligsource: REGISTRAR
eligdate: 2012-06-14T15:08:54Z
reachstatus: not identified
source: FRNIC

nic-hdl: SP13644-FRNIC
type: ORGANIZATION
contact: SDV PLURIMEDIA
address: SDV PLURIMEDIA
address: 15, rue de la nuée bleue
address: 67000 Strasbourg
country: FR(ANCE)
phone: +33 3 88 75 80 50
fax-no: +33 3 88 23 56 32
e-mail: domaines@sdv.fr
registrar: SDV PLURIMEDIA
changed: 2015-02-10T13:49:59Z nic@nic.fr
anonymous: NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: SASP1-FRNIC
type: ROLE
contact: Service-AFNIC SdV-Plurimedia
address: SDV PLURIMEDIA
address: 15, rue de la Nuee Bleue
address: 67000 Strasbourg
country: FR(ANCE)
e-mail: domaines@sdv.fr
admin-c: ML4155-FRNIC
tech-c: SG727-FRNIC
notify: domaines@sdv.fr
registrar: SDV PLURIMEDIA
changed: 2008-10-17T08:07:58Z domaines@sdv.fr
anonymous: NO
obsoleted: NO
eligstatus: not identified
reachstatus: not identified
source: FRNIC

nic-hdl: SG1540-FRNIC
type: ROLE
contact: Salim Gasmi
address: SDV PLURIMEDIA
address: 15, rue de la Nuee Bleue
address: 67000 Strasbourg
country: FR(ANCE)
phone: +33 3 88 75 80 50
e-mail: domaines@sdv.fr
admin-c: ML654-FRNIC
admin-c: ML1130-FRNIC
tech-c: SASP1-FRNIC
tech-c: SG727-FRNIC
registrar: SDV PLURIMEDIA
changed: 2008-10-16T15:58:31Z domaines@sdv.fr

Received: from mwinf5c43 (mwinf5c43 [10.223.111.93])

Whois IP 10.223.111.93

OrgAbuseHandle: IANA-IP-ARIN
OrgAbuseName: ICANN
OrgAbusePhone: +1-310-301-5820
OrgAbuseEmail: abuse@iana.org
OrgAbuseRef: https://rdap.arin.net/registry/entity/IANA-IP-ARIN

by mwinb2z06 with LMTPA;
Sun, 21 Jul 2019 03:36:39 +0200
X-Sieve: CMU Sieve 2.3
Received: from smtp6.tech.numericable.fr ([82.216.111.42])

Whois IP 82.216.111.42

Information related to 82.216.0.0 - 82.216.255.255

Abuse contact for 82.216.0.0 - 82.216.255.255 is abuse@gaoland.net

inetnum: 82.216.0.0 - 82.216.255.255
netname: FR-SFR-20031022
country: FR(ANCE)
org: ORG-VF1-RIPE
admin-c: LD699-RIPE
tech-c: LDC76-RIPE
status: ALLOCATED PA
mnt-by: RIPE-NCC-HM-MNT
mnt-by: SFR-MNT
mnt-routes: SFR-MNT
created: 2017-12-28T10:57:17Z
last-modified: 2017-12-28T10:57:17Z
source: RIPE

organisation: ORG-VF1-RIPE
org-name: SFR SA
org-type: LIR
remarks:xxxxxxxxxxxxxxxxxxxxxxx
For Hacking, Spamming or Security problems send mail to: | Pour les problèmes de piratage, de spam ou de sécurité, envoyez un courrier à : abuse@gaoland.net
remarks:xxxxxxxxxxxxxxxxxxxxxx
address: Campus SFR 12 rue Jean-Philippe Rameau - CS 80001
address: 93634
address: La-Plaine-Saint-Denis Cedex
address: FRANCE
phone: +33 1 70 18 52 00
fax-no: +33 1 70 18 11 61
abuse-c: AR15368-RIPE
admin-c: RB14609-RIPE
admin-c: LD699-RIPE
mnt-ref: RIPE-NCC-HM-MNT
mnt-ref: SFR-MNT
mnt-by: RIPE-NCC-HM-MNT
mnt-by: SFR-MNT
created: 2004-04-17T11:22:02Z
last-modified: 2018-02-14T09:51:57Z
source: RIPE # Filtered

role: SFR Legal Contact
address: Campus SFR
address: 12 rue Jean-Philippe Rameau
address: CS 80001
address: 93634 La-Plaine-Saint-Denis Cedex
address: France
phone: +33 1 70 18 52 00
admin-c: LDC76-RIPE
admin-c: BEO13-RIPE
tech-c: RB14609-RIPE
tech-c: BEO13-RIPE
nic-hdl: LD699-RIPE
abuse-mailbox: abuse@gaoland.net
mnt-by: LDCOM-MNT
created: 2003-10-23T09:15:54Z
last-modified: 2017-09-05T09:03:05Z
source: RIPE # Filtered

role: LDCOM Networks Tech Contact
address: SFR
address: CAMPUS SFR
address: 12 rue Jean-Philippe Rameau
address: CS 80001
address: 93634 La Plaine Saint-Denis Cedex
address: France
phone: +33 1 70 18 52 00
admin-c: LD699-RIPE
admin-c: LM5867-RIPE
admin-c: BEO13-RIPE
tech-c: DG1056-RIPE
nic-hdl: LDC76-RIPE
abuse-mailbox: abuse@gaoland.net
mnt-by: LDCOM-MNT
created: 2001-12-20T14:34:14Z
last-modified: 2016-12-14T09:33:06Z
source: RIPE # Filtered

Information related to 82.216.0.0/17AS21502

route: 82.216.0.0/17
descr: NUMERICABLE
origin: AS21502
mnt-by: NUMERICABLE-MNT
created: 2007-03-02T14:25:13Z
last-modified: 2008-06-18T15:01:30Z
source: RIPE

gaoland.net | http://gaoland.net/

Domain Information

Domain: gaoland.net
Registrar: SafeBrands SAS
Registered On: 2000-08-07
Expires On: 2019-08-07
Updated On: 2019-06-22
Status: clientTransferProhibited
Name Servers: nspri00.dns.sfr.net | nspri01.dns.sfr.net

Registrant / Administrative Contacts

Name: CHAMARD Claire
Organization: SOCIETE FRANCAISE DU RADIOTELEPHONE - SFR
Street: 1 SQUARE BELA BARTOK
City: Paris
Postal Code: 75015
Country: fr(ance)
Phone: +33.171080865
Email: domains@sfr.com

Technical Contact

Name: Host Master
Organization: SafeBrands
Street: Pole Media de la Belle de Mai 37 rue Guibal
City: Marseille cedex 03
Postal Code: 13356
Country: fr(ance)
Phone: +33.488662222
Fax: +33.488662220
Email: clientele@safebrands.com

Raw Whois Data
Domain Name: gaoland.net
Registrar WHOIS Server: whois.safebrands.com
Registrar URL: https://safebrands.com/
Updated Date: Jun 22 2019 05:02:00:000AM
Creation Date: 2000-08-07T14:33:07+02:00
Registrar Registration Expiration Date: 2019-08-07T14:33:07+02:00
Registrar: Safebrands SAS
Registrar IANA ID: 1290

Registrar Abuse Contact Email: legal@safebrands.com
Registrar Abuse Contact Phone: +33.488662222

Conformément aux dispositions de la loi informatique et libertés n ° 78-17 du 6 janvier 1978, vous disposez d'un droit d'accès, de rectification et de suppression des données personnelles que SafeBrands collecte auprès de vous. Vous pouvez obtenir plus d' informations sur ce sujet en se connectant au site https://safebrands.fr/wp-content/uploads/2013/10/www.cnil1.fr . Vos données personnelles sont collectées par nous dans le seul but de vous contacter conformément à la demande formulée. Vous pouvez nous contacter pour exercer ce droit, avec une copie de votre ID en pièce jointe, en écrivant par courrier électronique à l'adresse suivante:

compliance@safebrands.com

by mwinf5c43 with ME
id fDcc2000a0uwAFm01Dcdr4; Sun, 21 Jul 2019 03:36:39 +0200
X-bcc: prenom.nom@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (15)(0000)gggruggvucftvghtrhhoucdtuddrgeduvddrjedtgdegkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecugedttdenucgoteeftdduqddtudculdduhedmnecujfgurhephffvfffurfggoffkpfgtsehmtddtreertdejnecuhfhrohhmpedfrfgrthhrihgtvgcuueettffttegffdcuoehprghtrhhitggvrdgsrghrrhgruhesnhhoohhsrdhfrheqnecukfhppeekvddrvdduiedrudduuddrgedvpdefjedruddvtddrudegfedrgeenucfrrghrrghmpehhvghlohepshhmthhpiedrthgvtghhrdhnuhhmvghrihgtrggslhgvrdhfrhdpihhnvghtpeekvddrvdduiedrudduuddrgedvpdhmrghilhhfrhhomhepphgrthhrihgtvgdrsggrrhhrrghusehnohhoshdrfhhrpdhrtghpthhtohepphhhihhlihhpphgvrdhgrghsqhhuvghrvghssehorhgrnhhgvgdrfhhrpdhmohguvgepshhmthhpohhuthenucevlhhushhtvghrufhiiigvpedu
X-me-spamlevel: not-spam
X-ME-Helo: smtp6.tech.numericable.fr
X-ME-IP: 82.216.111.42
X-ME-Entity: ofr
Received: from mowmail-nc4.nc.sdv.fr (mowmail-nc4.tech.numericable.fr [82.216.111.104])

Whois IP 82.216.111.104

For Hacking, Spamming or Security problems send mail to: | Pour les problèmes de piratage, de spam ou de sécurité, envoyez un courrier à : abuse@gaoland.net

by smtp6.tech.numericable.fr (Postfix) with SMTP id 798A11834D8;
Sun, 21 Jul 2019 03:36:36 +0200 (CEST)
Received: from [37.120.143.4] by webmail.numericable.fr with http webmail;

Whois IP 37.120.143.4

Information related to 37.120.143.0 - 37.120.143.255

Abuse contact for 37.120.143.0 - 37.120.143.255 is abuse@s-data.ro

inetnum: 37.120.143.0 - 37.120.143.255
netname: M247-LTD-Brussels

M247 Ltd , Metronet UK Ltd et Venus Business Communications Ltd, exerçant sous le nom de M247. Enregistré en Angleterre et au Pays de Galles. Numéros enregistrés: 04968341, 04975343 & 04800517 Siège social: Turing House, Archway 5, Manchester M15 5RL

descr: M247 LTD Brussels Infrastructure
country: BE(LGIQUE)
geoloc: 50.8333 4.3333
admin-c: GBN16-RIPE
tech-c: GBN16-RIPE
status: ASSIGNED PA
mnt-by: SDAT-MNT
mnt-by: M247-EU-MNT
mnt-routes: GLOBALAXS-MNT
mnt-domains: GLOBALAXS-MNT
remarks:---- LEGAL CONCERNS ----
For any legal requests, please send an email to
ro-legal@m247.ro for a maximum 48hours response.

remarques: ----PRÉOCCUPATIONS JURIDIQUES ----
Pour toute demande légale, merci d'envoyer un email à
ro-legal@m247.ro pour une réponse maximum de 48 heures.

remarks:---- LEGAL CONCERNS ----
created: 2018-10-16T07:39:04Z
last-modified: 2018-12-30T14:26:45Z
source: RIPE

role: M247 Brussels NOC
address: Wezembeekstraat 2
address: 1930, Zaventem, Belgium
nic-hdl: GBN16-RIPE
abuse-mailbox: abuse@m247.ro
mnt-by: GLOBALAXS-MNT
created: 2016-03-03T08:32:09Z
last-modified: 2018-05-17T12:56:30Z
source: RIPE # Filtered

Interxion Belgium NV
Wezembeekstraat 2 bus 1
1930 Zaventem
Belgium
T: +32 2 709 03 60
F: +32 2 725 76 23
E: salesBE@interxion.com

role: GLOBALAXS NOC
remarks: M247 - Network Management Centre
address: 1 Ball Green, Cobra Court
address: M32 0QT, Manchester - United Kingdom
tech-c: JB3482-RIPE
tech-c: CB2407-RIPE
nic-hdl: GBXS-RIPE
abuse-mailbox: abuse@m247.ro
mnt-by: GLOBALAXS-MNT
created: 2006-07-13T15:37:05Z
last-modified: 2018-09-10T17:32:45Z
source: RIPE # Filtered

Information related to 37.120.143.0/24AS9009

route: 37.120.143.0/24
origin: AS9009
mnt-by: GLOBALAXS-MNT
created: 2018-10-16T14:24:54Z
last-modified: 2018-10-16T14:24:54Z
source: RIPE

GlobalAXS
@GlobalAXSCom
GlobalAXS Communications is a provider of high capacity connectivity services in London, Manchester, Amsterdam, Frankfurt, Prague, Milan, Paris and Brussels.
Manchester
globalaxs.com https://www.hugedomains.com/domain_profile.cfm?d=globalaxs&e=com
Inscrit en mai 2011
https://twitter.com/globalaxscom?lang=fr

Sun, 21 Jul 2019 03:36:36 +0200 (CEST)
X-EA-Auth: j3FzwElrvBNXq6fkjtp35cDsmczJ5tdZ56bMwS68PsyMxYh2VcPtbhbsVQ3
ALf/s/g1VRwHHKF9cZtQ5b8/laQ==
From: "Patrice BARRAU" patrice.barrau@noos.fr
To: patrice.barrau@noos.fr
Date: Sun, 21 Jul 2019 03:36:36 +0200 (CEST)
Subject: tr: INFORMATION
X-Priority: 3
MIME-Version: 1.0
X-Mailer: COMS/EA14.11/r20171018
Message-ID: ea-mime-5d33c1a4-1005-534b219a@webmail.numericable.fr
Disposition-Notification-To: patrice.barrau@noos.fr
Content-Type: multipart/mixed;
boundary=----=_NextPart_000_5d33c1a4_1005_57fb9714
X-VR-SPAMSTATE: OK
X-VR-SPAMSCORE: 15
X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduvddrjedtgdegkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfpfgfogfftkfevteeunffgpdfqfgfvnecuuegrihhlohhuthemuceftddtnecuogetfedtuddqtdduucdludehmdenucfjughrpefhvfffuffrggfokffptgesmhdttderredtjeenucfhrhhomhepfdfrrghtrhhitggvuceutefttfetfgdfuceophgrthhrihgtvgdrsggrrhhrrghusehnohhoshdrfhhrqeenucfkphepfeejrdduvddtrddugeefrdegnecurfgrrhgrmhepmhhouggvpehsmhhtphhouhhtnecuvehluhhsthgvrhfuihiivgepud

Il y a des millions de serveurs Internet piratés chaque jour de la même main, remplis de pirates informatiques.

Tous les webmasters ont les mêmes problèmes avec les pirates informatiques, les intrus, les attaquants et les spammeurs, mais personne ne se bat contre ces terroristes.

Non, nous luttons contre les pirates, les intrus, les attaquants, les spammeurs, les cyber-terroristes et le 185.156.173.146 !

Received and posted by Fraud Watcher/Advisor
Votre Commentaire / Vos ExplicationsPas concerné par l’objet de cet envoi de ce message.

Probabilité d'utilisation et d'usurpation abusives d'adresses emails légitimes de ces personnes victimes à leur insu (dans certains cas) souvent utilisées comme émetteur de l'envoi supposé pour passer entre les mailles du filet (filtres) d'un logiciel quelconque qui ne détecte pas la présence d'un SPAM ou d'un courrier indésirable.

L’adresse email de l’émetteur est la même pour le destinataire :

« De : Patrice BARRAU [mailto:patrice.barrau@noos.fr]
Envoyé : dimanche 21 juillet 2019 03:37
À : patrice.barrau@noos.fr
Objet : tr: INFORMATION »

Sauf que mon adresse courriel est masquée toujours par la sienne et ses semblables.

« Chère cliente, cher client, » n’est pas approprié pour annoncer que vous avez gagné à la loterie alors que je suis bien placé pour le savoir que je n’ai (jamais) participé à ce jeu du hasard quelconque et encore moins « un client » comme il le prétend.

Sachant qu’il n’a pas la présence physique d’un vrai virus informatique dans ce fichier joint car sinon, il n’y a aucun intérêt pour lui (l’escroc) et ses victimes d'empêcher de lire son contenu «WIN-WIN.png » avec son adresse email de l’escroc visible sur le faux document joint.

Jusqu’à présent, je n’ai jamais reçu ce type d’arnaque de ce genre sauf pour commenter les autres qu’ils ont déjà reçus et signaler sur ce site.

« Nous avons le plaisir de vous informer du tirage au sort du programme spécial MY MILLIONS By MEGA MILLIONS. Votre adresse électronique attachée à un Nombre de série : CPTNB/3615/19 a tiré les Nombres Gagnants : 7 - 18 - 29 - 32 - 17 - 45, qui vous ont par la suite permis de partager la cagnotte de 30 millions d’euros en jeu »

Cet escroc ignore (ou le sait mieux que moi) que ce MEGA MILLIONS se joue uniquement aux USA et le montant de la cagnotte est toujours en US Dollar$ et jamais en €uros.
Piece(s) jointe(s)
Autres Référenceshttps://www.signal-arnaques.com/scam/view/166373 (2 commentaires)
https://www.signal-arnaques.com/scam/view/169254 (1 commentaire)
https://www.signal-arnaques.com/scam/view/169997 (1 commentaire)
https://www.signal-arnaques.com/scam/view/170742 (1 commentaire)
Pour en Savoir +Numéro de téléphone dangereux détecté dans ce signalement d'arnaque: Lisez cet article.
Arnaques de loteries: Comprenez leur fonctionnement !
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !

2 commentaires


  • Fraud Watcher/Advisor le 21/07/2019 à 22:01

    Arnaque confirmée à propos de l'utilisation et d'usurpation abusives d'identité non autorisée des marques déposées ou de service, des logos (Powerball®/ Mega Millions® / Lottery.com®) et des noms commerciaux de Mega Millions®

    Chez Lottery.com, nous prenons votre sécurité et vos rapports de fraude très au sérieux. Des cas d'arnaqueurs de loterie pouvant prétendre être des employés d'un conseil de loterie ou de Lottery.com ont été rapportés. Ils peuvent utiliser les logos de loterie réels (Powerball ou Mega Millions) et les logos de société Lottery.com.

    Évitez d'être victime d'une arnaque en prenant conscience de ce qui suit :

    • Les employés de Lottery.com ne vous demanderont JAMAIS de l'argent.

    • N'envoyez jamais d'argent à un destinataire inconnu. Cela inclut les chèques, les mandats, les cartes prépayées, les virements électroniques ou tout autre type de paiement.

    • Lottery.com ne vous demandera jamais de transférer de l'argent. Les détails de votre paiement ne seront utilisés que pour jouer à la loterie au sein de l'application. Pour alimenter votre compte, vous ne le faites que dans l'application Lottery.com.

    • Lottery.com ne vous demandera jamais d'expédier quoi que ce soit.

    • Toutes les transactions sont gérées dans l'application Lottery.com. Ne répondez à aucune tierce partie qui vous contacte concernant un type de transaction, des informations personnelles ou un paiement.

    • Ne répondez à aucune question sur le fait de gagner à la loterie si vous avez joué avec Lottery.com. Lottery.com vous informera directement dans l'application.... Lire la suite

    Répondre
  • Fraud Watcher/Advisor le 21/07/2019 à 22:35

    Vous recevez un appel ou une lettre vous informant que vous pouvez gagner des millions dans une loterie étrangère. Est-ce votre jour de chance ? C'est probablement une arnaque qui profite de votre enthousiasme pour réclamer un gros prix.

    • Les escrocs profitent de notre désir naturel de gagner. Vous voyez des loteries d'État et autres concours annoncés tout le temps. Pourquoi ne serait-ce pas votre tour de gagner ? Ainsi, lorsque quelqu'un présente la possibilité de jouer à une loterie étrangère, cela peut sembler être l'occasion idéale.

    • Il est illégal d'utiliser le courrier ou le téléphone pour jouer à des loteries transfrontalières. La loi américaine l'interdit, non seulement au-delà des frontières nationales, mais aussi entre les frontières des États. Vous pourriez donc être accusé d'activités illégales simplement en participant.

    • Peu importe à quel point ces sollicitations ont l'air officielles, elles ne sont pas réelles. Parfois, les loteries existent réellement, mais les invitations à jouer ne proviennent pas de gouvernements qui gèrent des loteries légitimes ou de quiconque qui y est connecté. Et il n'y a aucun moyen de garantir que vous n’obtiendrez jamais les billets que vous payez ou, dans le cas improbable où vous gagneriez, vous pourrez collecter l'argent. Les escrocs vont tout simplement l'empocher.

    • Rejoindre un «club» de loterie n'augmentera pas vos chances de gagner des loteries étrangères. Les escrocs prétendent que la mise en commun de votre argent avec d'autres personnes signifie que vous pouvez acheter plus de billets et avoir plus de chances de gagner. Mais les chances de gagner restent minimes et vous ne savez toujours pas si les billets seront réellement achetés ou si vous ne pourrez jamais les collecter.... Lire la suite

    Répondre
Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Italien Allemand Espagnol