Arnaque identité (Phishing) : bponline@wanadoo.fr

ARNAQUE SUSPECTÉE !!!

Date02/08/2019
Pseudonyme utilisébponline@wanadoo.fr
Contenu de l'arnaqueReturn-Path:
Received: from opme11dod06aub.bagnolet.francetelecom.fr ([10.79.3.107])
by opme11dob28aub.bagnolet.francetelecom.fr with LMTP id gMStF6aWQ11nMQAALk7Ukg
; Fri, 02 Aug 2019 03:49:26 +0200
Received: from opme11ppr05aub.bagnolet.francetelecom.fr ([10.79.3.107])
by opme11dod06aub.bagnolet.francetelecom.fr with LMTP id ADSRF6aWQ13kIQAAOHZ91g
; Fri, 02 Aug 2019 03:49:26 +0200
Received: from mwinf5c06 ([10.79.3.107])
by opme11ppr05aub.bagnolet.francetelecom.fr with LMTP id 8BGrFqaWQ12vOwAA+DRNVg
; Fri, 02 Aug 2019 03:49:26 +0200
Received: from a8-70.smtp-out.amazonses.com ([54.240.8.70])
by mwinf5c06 with ME
id k1oa2000x1WfmMi011pQB6; Fri, 02 Aug 2019 03:49:26 +0200
X-bcc: patrick.gantet@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (17)(0000)gggruggvucftvghtrhhoucdtuddrgeduvddrleekgdehvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecugedttdenucdnofetkffnkffpifculddujedmnecujfgurhephffvufffggfktgesrhdtreertddtjeenucfhrhhomhepsghpohhnlhhinhgvseifrghnrgguohhordhfrhenucffohhmrghinheprgifshhtrhgrtghkrdhmvgdpvddtvddrgeeirdduheeirdeknecukfhppeehgedrvdegtddrkedrjedtnecurfgrrhgrmhephhgvlhhopegrkedqjedtrdhsmhhtphdqohhuthdrrghmrgiiohhnshgvshdrtghomhdpihhnvghtpeehgedrvdegtddrkedrjedtpdhmrghilhhfrhhomheptddutddttdduiegthedttdegiegtfhekqdefsgefleeitgekfhdqrgehvdejqdegjedvvddqkeeltgehqdgsfhelfeelieefugekiegrrgdqtddttddttddtsegrmhgriihonhhsvghsrdgtohhmpdhrtghpthhtohepphgrthhrihgtkhdrghgrnhhtvghtsehorhgrnhhgvgdrfhhrnecuvehluhhsthgvrhfuihiivgeptd
X-me-spamlevel: not-spam
X-ME-Helo: a8-70.smtp-out.amazonses.com
X-ME-IP: 54.240.8.70
X-ME-Entity: ofr
DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple;
s=6gbrjpgwjskckoa6a5zn6fwqkn67xbtw; d=amazonses.com; t=1564710564;
h=From:To:Subject:Date:MIME-Version:Message-ID:Content-Type:Feedback-ID;
bh=HNmwTZcQ2AmD0F6CSzwkLC6Z0ZHJFpGk6l6i7zNOcuM=;
b=GZ7imLt+H9VQdkhdGv+LLh8AISr/GVTXdh8ybEtK3lQUyklsvIEj/R0TPXKkIvFG
9zWy0mq5jeKvSNQaMbb0imspAQ5BFQhPTg/8Gg4r6KlCLBSnhDMzNmFFcQL5waJMHkW
yPBCIgIVFMpZGiYVZH96YXqujkIWyPdaWltkGbcg=
From: bponline@wanadoo.fr
To: patrick.gantet@orange.fr
Subject: =?utf-8?B?TCdhdXRoZW50aWZpY2F0aW9uIGVzdCBkw6lzb3JtYWlzIG9ibGlnYXRvaXJl?=
Date: Fri, 2 Aug 2019 01:49:23 +0000
MIME-Version: 1.0
Message-ID:
Content-Type: multipart/related; boundary="--=_Next_7A11_20180724_EC12.0.8.2608"
X-SES-Outgoing: 2019.08.02-54.240.8.70
Feedback-ID: 1.us-east-1.XI0rbsnPYH8afulEhVSihYcT7NAAbrF8543cU3CBFFE=:AmazonSES
X-Antispam: clean, score=30
X-Antivirus: AVG (VPS 190801-6, 01/08/2019), Inbound message
X-Antivirus-Status: Clean

This is a multi-part message in MIME format.
----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: text/html; charset="utf-8"
Content-Transfer-Encoding: quoted-printable

body,p,div,td { font-family: Arial; }

Si
cet email ne s'affiche pas correctement, vous pouvez le
visualiser gr=C3=A2ce
=C3=A0 ce lien.

Cher
Client ,

Pour vous assurer toujours plus de s=C3=
=A9curit=C3=A9
dans la gestion de vos comptes en ligne, =
;nous
proposons un nouveau service : Certicode Plus=
.

Totalement gratuit, ce service vous donn=
era
un acc=C3=A8s simplifi=C3=A9 =C3=A0 toujours =
plus de
services.

=E2=80=A6
D=C3=89COUVREZ LE

Entr=C3=A9e
en vigueur de la DSP2 :

Pour
renforcer la s=C3=A9curit=C3=A9 des achats en=
ligne, la
directive europ=C3=A9enne DSP2 s=E2=80=99appr=
=C3=AAte =C3=A0 rendre
obligatoire le principe de l=E2=80=99authenti=
fication
forte pour tous les achats en ligne. Par
cons=C3=A9quent, Le service Certicode Plus co=
nstituera
une condition n=C3=A9cessaire pour acc=C3=A9d=
er =C3=A0 votre
Espace Client.

Certicode Plus le nouveau servic=
e
d=E2=80=99authentification forte permettant d=
e s=C3=A9curiser
la validation des op=C3=A9rations dites =C2=
=AB engageantes
ou sensibles =C2=BB r=C3=A9alis=C3=A9es depui=
s l=E2=80=99Espace Client
Internet ou depuis l=E2=80=99application mobi=
le.

Pour
cela, vous devez vous connecter sur le site e=
t
acc=C3=A9der =C3=A0 votre espace s=C3=A9curis=
=C3=A9 en ligne en
saisissant vos identifiant et mot de
passe.

Connectez-vous

POUR
EN SAVOIR PLUS, PRENDRE RENDEZ-VOUS OU SOUSCRIRE
:

NOUS
CONTACTER=

TROUVER
UNBUREAU =
DE
POSTE

=C3=8ATRE
RAPPEL=C3=89ULT=C3=89RIEU=
REMENT

L=E2=80=99inves=
tissement OPC
comporte des risques. La valeur des investissements=
et
les revenus qu=E2=80=99ils g=C3=A9n=C3=A8rent peuve=
nt enregistrer des
hausses comme des baisses et il se peut que les
investisseurs ne r=C3=A9cup=C3=A8rent pas l=E2=80=
=99int=C3=A9gralit=C3=A9 de leur
placement. Le placement en Bourse est risqu=C3=A9, =
vous
pouvez subir des pertes. Les performances pass=C3=
=A9es ne
pr=C3=A9jugent pas des performances futures. Elles =
ne sont
pas constantes dans le temps. Les informations cont=
enues
dans ce document sont donn=C3=A9es =C3=A0 titre d=
=E2=80=99information
uniquement. Elles ne constituent pas un conseil en
investissement ni une recommandation d=E2=80=99inve=
stir. Les
Documents d=E2=80=99Informations Cl=C3=A9s pour l=
=E2=80=99Investisseur (DICI)
sont disponibles dans les Bureaux de Poste et vous =
devez
en avoir pris pr=C3=A9alablement connaissance avant=
toute
souscription. Ils doivent faire l=E2=80=99objet d=
=E2=80=99une lecture
attentive par le client. Pour une description plus
compl=C3=A8te de l'OPC, consulter les documents
r=C3=A9glementaires, disponibles gratuitement sur s=
imple
demande.Conform=C3=A9ment =C3=
=A0 la
r=C3=A9glementation relative =C3=A0 la protection d=
es donn=C3=A9es =C3=A0
caract=C3=A8re personnel, vous disposez d=E2=80=99u=
n droit d=E2=80=99acc=C3=A8s,
de rectification, d'effacement, d=E2=80=99oppositio=
n et de
limitation du traitement. Vous pouvez faire une dem=
ande
de portabilit=C3=A9 pour les donn=C3=A9es que vous =
nous avez
fournies et qui sont n=C3=A9cessaires au contrat ou=
au
traitement desquelles vous avez consenti. Vous pouv=
ez =C3=A0
tout moment retirer votre consentement lorsque celu=
i-ci
a =C3=A9t=C3=A9 pr=C3=A9alablement donn=C3=A9. Vous=
pouvez aussi donner des
instructions relatives =C3=A0 la conservation, =C3=
=A0 l=E2=80=99effacement
et =C3=A0 la communication de vos donn=C3=A9es apr=
=C3=A8s votre
d=C3=A9c=C3=A8s.Ces droits peuvent =
=C3=AAtre
exerc=C3=A9s, en pr=C3=A9cisant vos nom, pr=C3=A9no=
m, adresse et en
joignant une copie recto-verso de votre pi=C3=A8ce
d=E2=80=99identit=C3=A9, en s'adressant par courrie=
r au responsable
de traitement, La Banque - Service Relations Client=
s -
115, rue de S=C3=A8vres - 75275 Paris Cedex 06.Si vous ne souhaitez =
plus
recevoir d'emails sur les fonds boursiers de La Ban=
que ,
vous pouvez vous d=C3=A9sinscrire.

----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/gif; name="lbp_10147_r6_c21.gif"
Content-Transfer-Encoding: base64
Content-ID:

R0lGODlhoAAZAJEAALi4uP///////wAAACH5BAEHAAIALAAAAACgABkAAAJOjI+py+0Po5y02ouz
3rz7D4biSJbmiabqyrbuC8fyTNf2jef6zvf+DwwKh8Si8YhMKpcIgPMJjUqn1Kr1inUyt9yu9wsO
i8fksvmMTqsLADs=
----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/gif; name="lbp_10147_r6_c10.gif"
Content-Transfer-Encoding: base64
Content-ID:

R0lGODlhQAEZAJEAALi4uP///////wAAACH5BAEHAAIALAAAAABAARkAAAJ7jI+py+0Po5y02ouz
3rz7D4biSJbmiabqyrbuC8fyTNf2jef6zvf+DwwKh8Si8YhMKpfMpvMJjUqn1Kr1is1qt9yu9wsO
i8fksvmMVgLW7Lb7DY/L5/S6/Y7P6/f8vv8PGNiXRlhoeIiYqLjI2Oj4CBkpOUlZaXmJmVgAADs=

----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/gif; name="lbp_10147_r6_c1.gif"
Content-Transfer-Encoding: base64
Content-ID:

R0lGODlhQAEZAJEAALi4uP///////wAAACH5BAEHAAIALAAAAABAARkAAAJ5jI+py+0Po5y02ouz
3rz7D4biSJbmiabqyrbuC8fyTNf2jef6zvf+DwwKh8Si8YhMKpfMpvMJjUqn1Kr1is1qt9yu9wsO
i8fksvmMTtcA7Lb7DY/L5/S6/Y7P6/f8vv8/pyY4SFhoeIiYqLjI2Oj4CBkpOUlZaZlVAAA7
----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/gif; name="liv_11_21.gif"
Content-Transfer-Encoding: base64
Content-ID:

R0lGODlhNAA1ANUAADk5OU5OTj4+Ps/Pz2FhYYODg+bm5t/f38fHx9vb26qqqjo6OkZGRmBgYFRU
VPX19fv7+7GxsZOTk6Ojo/T09Ht7e/39/YaGhl5eXpKSku7u7nR0dOLi4nBwcKysrEFBQVlZWYeH
h319ffj4+FJSUkRERDs7O/Ly8ri4uGdnZ+Xl5aSkpPr6+vf397m5udfX19nZ2fb29vz8/GZmZqWl
pY6OjkBAQI+Pj0JCQj09PTU1Nf///wAAAAAAAAAAAAAAACH/C1hNUCBEYXRhWE1QPD94cGFja2V0
IGJlZ2luPSLvu78iIGlkPSJXNU0wTXBDZWhpSHpyZVN6TlRjemtjOWQiPz4gPHg6eG1wbWV0YSB4
bWxuczp4PSJhZG9iZTpuczptZXRhLyIgeDp4bXB0az0iQWRvYmUgWE1QIENvcmUgNS42LWMxMTEg
NzkuMTU4MzI1LCAyMDE1LzA5LzEwLTAxOjEwOjIwICAgICAgICAiPiA8cmRmOlJERiB4bWxuczpy
ZGY9Imh0dHA6Ly93d3cudzMub3JnLzE5OTkvMDIvMjItcmRmLXN5bnRheC1ucyMiPiA8cmRmOkRl
c2NyaXB0aW9uIHJkZjphYm91dD0iIiB4bWxuczp4bXBNTT0iaHR0cDovL25zLmFkb2JlLmNvbS94
YXAvMS4wL21tLyIgeG1sbnM6c3RSZWY9Imh0dHA6Ly9ucy5hZG9iZS5jb20veGFwLzEuMC9zVHlw
ZS9SZXNvdXJjZVJlZiMiIHhtbG5zOnhtcD0iaHR0cDovL25zLmFkb2JlLmNvbS94YXAvMS4wLyIg
eG1wTU06T3JpZ2luYWxEb2N1bWVudElEPSJ4bXAuZGlkOjlFNTExNDg4RUE1QUUwMTFBRjlGRTM0
RDcyMTQ3MTUxIiB4bXBNTTpEb2N1bWVudElEPSJ4bXAuZGlkOjg3Qzk4NEE5NDFCQzExRTZCQjdC
RDFCRTBGRTJFM0QxIiB4bXBNTTpJbnN0YW5jZUlEPSJ4bXAuaWlkOjg3Qzk4NEE4NDFCQzExRTZC
QjdCRDFCRTBGRTJFM0QxIiB4bXA6Q3JlYXRvclRvb2w9IkFkb2JlIFBob3Rvc2hvcCBDQyAyMDE1
IChXaW5kb3dzKSI+IDx4bXBNTTpEZXJpdmVkRnJvbSBzdFJlZjppbnN0YW5jZUlEPSJ4bXAuaWlk
OjM2OWVhZThlLTU1MDgtZmY0NC05MTA5LTIxNTliYjM0YTcyZiIgc3RSZWY6ZG9jdW1lbnRJRD0i
YWRvYmU6ZG9jaWQ6cGhvdG9zaG9wOmRhZGI4NjVlLTNlOWMtMTFlNi04MDIxLWUxNzUyYWFhNDUx
NCIvPiA8L3JkZjpEZXNjcmlwdGlvbj4gPC9yZGY6UkRGPiA8L3g6eG1wbWV0YT4gPD94cGFja2V0
IGVuZD0iciI/PgH//v38+/r5+Pf29fTz8vHw7+7t7Ovq6ejn5uXk4+Lh4N/e3dzb2tnY19bV1NPS
0dDPzs3My8rJyMfGxcTDwsHAv769vLu6ubi3trW0s7KxsK+urayrqqmop6alpKOioaCfnp2cm5qZ
mJeWlZSTkpGQj46NjIuKiYiHhoWEg4KBgH9+fXx7enl4d3Z1dHNycXBvbm1sa2ppaGdmZWRjYmFg
X15dXFtaWVhXVlVUU1JRUE9OTUxLSklIR0ZFRENCQUA/Pj08Ozo5ODc2NTQzMjEwLy4tLCsqKSgn
JiUkIyIhIB8eHRwbGhkYFxYVFBMSERAPDg0MCwoJCAcGBQQDAgEAACH5BAAAAAAALAAAAAA0ADUA
AAb/wJ1wSCwaj8ikcslsOp/QqHRKrVqv2OwhgxHovgJM5pB1tkLftPobipWVI8J6/iWM3sgbfV/D
GzUAe3QAGn5EEYJ7EYZDF4l0F4xCHY9zHZI7cpVqBJgkm2okmAGgaQGjpV+nkqSpq4YGJqk6JgaM
HrNfHow0uTorjAO+A5IisyKYEDilNiyYOwWlBc87L6Uw1DsbmxvZOypeiQK23iiPLt5DH4If6UIJ
gXsACekDJY8lxM8WE/GPABMsSOKQYtYMDn4eSFjga4GEB1lkKGDgSw0DBRCsIHBQkY4DBFMoVOiY
qAIFKCdAkHwE4sSTaCsfTXMSLqagHE9sVsqpMxHPGJ57fgKdI3SomicNjK5p4K6p06dQo5YJAgA7

----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/gif; name="liv_11_19.gif"
Content-Transfer-Encoding: base64
Content-ID:

R0lGODlhMgA1AOYAAPn5+V1dXfLy8sLCwkZGRu3t7d/f3zY2NoeHhzc3N/7+/v39/VVVVdLS0omJ
iXJycp+fn+bm5kJCQjk5OV5eXnBwcN7e3vr6+urq6vPz87e3t1hYWOLi4rS0tKqqqsHBwaSkpNXV
1ba2tsjIyKampvf39z4+Pvz8/ENDQ4+Pj19fX0pKSmFhYX9/f01NTbCwsGtrazg4OJKSkjw8PFJS
Uj09PUBAQDs7O3V1dWpqan5+fszMzGhoaE5OTpGRkaurq9bW1vv7+/Hx8ZSUlGVlZYqKipqamufn
55OTk5CQkM/Pz0RERM7Ozm5ubqKiovX19UVFRTo6OnNzc1dXV9PT01ZWVltbW6CgoJeXl4uLi4CA
gI2NjeDg4EFBQYiIiIGBgZycnDU1Nf///wAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAACH/
C1hNUCBEYXRhWE1QPD94cGFja2V0IGJlZ2luPSLvu78iIGlkPSJXNU0wTXBDZWhpSHpyZVN6TlRj
emtjOWQiPz4gPHg6eG1wbWV0YSB4bWxuczp4PSJhZG9iZTpuczptZXRhLyIgeDp4bXB0az0iQWRv
YmUgWE1QIENvcmUgNS42LWMxMTEgNzkuMTU4MzI1LCAyMDE1LzA5LzEwLTAxOjEwOjIwICAgICAg
ICAiPiA8cmRmOlJERiB4bWxuczpyZGY9Imh0dHA6Ly93d3cudzMub3JnLzE5OTkvMDIvMjItcmRm
LXN5bnRheC1ucyMiPiA8cmRmOkRlc2NyaXB0aW9uIHJkZjphYm91dD0iIiB4bWxuczp4bXBNTT0i
aHR0cDovL25zLmFkb2JlLmNvbS94YXAvMS4wL21tLyIgeG1sbnM6c3RSZWY9Imh0dHA6Ly9ucy5h
ZG9iZS5jb20veGFwLzEuMC9zVHlwZS9SZXNvdXJjZVJlZiMiIHhtbG5zOnhtcD0iaHR0cDovL25z
LmFkb2JlLmNvbS94YXAvMS4wLyIgeG1wTU06T3JpZ2luYWxEb2N1bWVudElEPSJ4bXAuZGlkOjlF
NTExNDg4RUE1QUUwMTFBRjlGRTM0RDcyMTQ3MTUxIiB4bXBNTTpEb2N1bWVudElEPSJ4bXAuZGlk
Ojg3QzYyOTNBNDFCQzExRTZCQjdCRDFCRTBGRTJFM0QxIiB4bXBNTTpJbnN0YW5jZUlEPSJ4bXAu
aWlkOjg3QzYyOTM5NDFCQzExRTZCQjdCRDFCRTBGRTJFM0QxIiB4bXA6Q3JlYXRvclRvb2w9IkFk
b2JlIFBob3Rvc2hvcCBDQyAyMDE1IChXaW5kb3dzKSI+IDx4bXBNTTpEZXJpdmVkRnJvbSBzdFJl
ZjppbnN0YW5jZUlEPSJ4bXAuaWlkOjM2OWVhZThlLTU1MDgtZmY0NC05MTA5LTIxNTliYjM0YTcy
ZiIgc3RSZWY6ZG9jdW1lbnRJRD0iYWRvYmU6ZG9jaWQ6cGhvdG9zaG9wOmRhZGI4NjVlLTNlOWMt
MTFlNi04MDIxLWUxNzUyYWFhNDUxNCIvPiA8L3JkZjpEZXNjcmlwdGlvbj4gPC9yZGY6UkRGPiA8
L3g6eG1wbWV0YT4gPD94cGFja2V0IGVuZD0iciI/PgH//v38+/r5+Pf29fTz8vHw7+7t7Ovq6ejn
5uXk4+Lh4N/e3dzb2tnY19bV1NPS0dDPzs3My8rJyMfGxcTDwsHAv769vLu6ubi3trW0s7KxsK+u
rayrqqmop6alpKOioaCfnp2cm5qZmJeWlZSTkpGQj46NjIuKiYiHhoWEg4KBgH9+fXx7enl4d3Z1
dHNycXBvbm1sa2ppaGdmZWRjYmFgX15dXFtaWVhXVlVUU1JRUE9OTUxLSklIR0ZFRENCQUA/Pj08
Ozo5ODc2NTQzMjEwLy4tLCsqKSgnJiUkIyIhIB8eHRwbGhkYFxYVFBMSERAPDg0MCwoJCAcGBQQD
AgEAACH5BAAAAAAALAAAAAAyADUAAAf/gGKCg4SCBiQ4DCZhYSYMOCQGhZOUlZYnHSqMm5ybKh0n
lqKjYiM0naidNCOkrYMACKmynQgArqNCLLO7myxCt5UCG7zEYRsCwIUXRMXFRBfJgynNzSnRYg3U
1A3JCgHazQEKwAPNUxUVVc0DwDm8MVlHhBFFMbw5txgHu1BKlUxLdh3A4OrFrihURDWYsOuFqxa7
jJDCsquFq2+ybjwhJeDGrACuUMx64KrJLBSudiFxJWNXylkQXIFx2arGrC2uisyq4WrFLAqurMxa
4QrGLkmjLOyC4crHLimkKuzy4arcLieirvBi1wpAF14yoBUCkISXBFuuYvHqAYILAAAGw0D0IIYA
GIcE4Iol4JBMS15iX6IVsPF3lo0C1zwUluXhmpgFGBdvCrDAsZgQ+ySHORDCsiAHmsN48SxIAAHJ
BJCRFiNCsojVghTwKMxjHGwxFhiCm2Dh9qAheYf4HlTChTYXJYYP+qDtg3JCD5qRfD4owgxiMyJQ
JwSBWMztg4Iw2MUgCHhCO3btOF9Ihywd7AsVkIBKAuL4hH6g+oG/0AIKnFBQWX+EAIFXGAkAQeAk
oIXhwIKTZEAAARlAOIkGGlAXCAA7
----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/gif; name="liv_11_16.gif"
Content-Transfer-Encoding: base64
Content-ID:

R0lGODlhNAA1AOYAAP7+/v39/Tc3N1paWvX19YODgzY2NtbW1uDg4O7u7pycnMvLy5+fn42NjTw8
PENDQ/z8/GhoaJqamoaGhjs7O6WlpaOjo6KioltbW15eXubm5qampvr6+n19fVFRUcfHx1VVVZ2d
nVJSUkJCQvn5+a6urpaWlvLy8kBAQOnp6evr66GhofPz876+vomJiYGBgbCwsO/v73t7e11dXVxc
XExMTPf393x8fM7Ozvv7+3d3d5GRkbm5uX9/f2NjY0hISISEhGZmZkZGRj4+PmBgYG9vb0VFRT09
PcjIyPHx8WdnZzg4OPT09GRkZM3NzcTExHR0dIKCgtjY2H5+ftnZ2crKysHBweHh4d/f3729vVdX
V5mZmYyMjNTU1I6Ojufn58XFxeLi4ri4uDU1Nf///wAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAACH/
C1hNUCBEYXRhWE1QPD94cGFja2V0IGJlZ2luPSLvu78iIGlkPSJXNU0wTXBDZWhpSHpyZVN6TlRj
emtjOWQiPz4gPHg6eG1wbWV0YSB4bWxuczp4PSJhZG9iZTpuczptZXRhLyIgeDp4bXB0az0iQWRv
YmUgWE1QIENvcmUgNS42LWMxMTEgNzkuMTU4MzI1LCAyMDE1LzA5LzEwLTAxOjEwOjIwICAgICAg
ICAiPiA8cmRmOlJERiB4bWxuczpyZGY9Imh0dHA6Ly93d3cudzMub3JnLzE5OTkvMDIvMjItcmRm
LXN5bnRheC1ucyMiPiA8cmRmOkRlc2NyaXB0aW9uIHJkZjphYm91dD0iIiB4bWxuczp4bXBNTT0i
aHR0cDovL25zLmFkb2JlLmNvbS94YXAvMS4wL21tLyIgeG1sbnM6c3RSZWY9Imh0dHA6Ly9ucy5h
ZG9iZS5jb20veGFwLzEuMC9zVHlwZS9SZXNvdXJjZVJlZiMiIHhtbG5zOnhtcD0iaHR0cDovL25z
LmFkb2JlLmNvbS94YXAvMS4wLyIgeG1wTU06T3JpZ2luYWxEb2N1bWVudElEPSJ4bXAuZGlkOjlF
NTExNDg4RUE1QUUwMTFBRjlGRTM0RDcyMTQ3MTUxIiB4bXBNTTpEb2N1bWVudElEPSJ4bXAuZGlk
Ojg3QzYyOTM2NDFCQzExRTZCQjdCRDFCRTBGRTJFM0QxIiB4bXBNTTpJbnN0YW5jZUlEPSJ4bXAu
aWlkOjg3QzYyOTM1NDFCQzExRTZCQjdCRDFCRTBGRTJFM0QxIiB4bXA6Q3JlYXRvclRvb2w9IkFk
b2JlIFBob3Rvc2hvcCBDQyAyMDE1IChXaW5kb3dzKSI+IDx4bXBNTTpEZXJpdmVkRnJvbSBzdFJl
ZjppbnN0YW5jZUlEPSJ4bXAuaWlkOjM2OWVhZThlLTU1MDgtZmY0NC05MTA5LTIxNTliYjM0YTcy
ZiIgc3RSZWY6ZG9jdW1lbnRJRD0iYWRvYmU6ZG9jaWQ6cGhvdG9zaG9wOmRhZGI4NjVlLTNlOWMt
MTFlNi04MDIxLWUxNzUyYWFhNDUxNCIvPiA8L3JkZjpEZXNjcmlwdGlvbj4gPC9yZGY6UkRGPiA8
L3g6eG1wbWV0YT4gPD94cGFja2V0IGVuZD0iciI/PgH//v38+/r5+Pf29fTz8vHw7+7t7Ovq6ejn
5uXk4+Lh4N/e3dzb2tnY19bV1NPS0dDPzs3My8rJyMfGxcTDwsHAv769vLu6ubi3trW0s7KxsK+u
rayrqqmop6alpKOioaCfnp2cm5qZmJeWlZSTkpGQj46NjIuKiYiHhoWEg4KBgH9+fXx7enl4d3Z1
dHNycXBvbm1sa2ppaGdmZWRjYmFgX15dXFtaWVhXVlVUU1JRUE9OTUxLSklIR0ZFRENCQUA/Pj08
Ozo5ODc2NTQzMjEwLy4tLCsqKSgnJiUkIyIhIB8eHRwbGhkYFxYVFBMSERAPDg0MCwoJCAcGBQQD
AgEAACH5BAAAAAAALAAAAAA0ADUAAAf/gGSCg4SFhoeIiYqLjI2Oj5CRil0WJh8JAJKahwsDY5+g
XBCbpAqgp58lpJpbqKgFq5FWrqgzsY8BP7SnFAG3jU67qFe/jDTCp1nFihDIpxLLiRrOoDfRiDDU
nxHXh0DaYwPdhgzg4uOET+BK6IQp4CHthA/UHSTyg0XIQjz4hBa7BLg44Y8QlV0KChYKQM/VCoWF
ZNACAZFQi10HKgoigYIWLI1kptBykATkh13QNAIQQesBAZAVdjEAeeIILRQJQDbYNQGkCgq0BEjR
uQvDqIoJhuwyAfLCLgNINOYAsWsEAkUHQmRctkBYjRSHAKwQMEbAhmgFhHkIU4iADlQNdHz9IsBy
l5EFg7BooQXFRrEDS4QZ8FKFgQNhGTQUiwlO2AgwxXo0Fibgwi8OESYLS3iLBRHNtAy8vBUjA2hX
ozsHOX0qUzEOL1iP6XmtxGHQKsYhaKLZRTsAYjyAKyBX3pcdBoQNaKGRCY4oGAb46LDhKqRAADs=

----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/gif; name="lbp_10147_r2_c21.gif"
Content-Transfer-Encoding: base64
Content-ID:

R0lGODlhoAAUAJEAALi4uP///////wAAACH5BAEHAAIALAAAAACgABQAAAJGhI+py+0PTZi02ouz
3rz7D4biSJbmiabqyrbuC8fyTNf2jef6zvf+DwwKh8Si8YhMKpfMpvMJjUqn1Kr1is1qt9yu94sr
AAA7
----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/gif; name="lbp_10147_r2_c10.gif"
Content-Transfer-Encoding: base64
Content-ID:

R0lGODlhQAEUAJEAALi4uP///////wAAACH5BAEHAAIALAAAAABAARQAAAJthI+py+0Po5y02ouz
3hyHD4biSJbmiabqyrbuC8fyTNf2jef6zvf+DwwKh8Si8YhMKpfMpvMJjUqn1Kr1is1qt9yu9wsO
i8fksvmMTqvX7Lb7DY/L5/S6/Y7P6/f8vv8PGCg4SFhoeIiYqChXAAA7
----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/gif; name="lbp_10147_r2_c1.gif"
Content-Transfer-Encoding: base64
Content-ID:

R0lGODlhQAEUAJEAALi4uP///////wAAACH5BAEHAAIALAAAAABAARQAAAJsjI+py+0PDZi02ouz
3rz7D4biSJamFqXqyrbuC8fyTNf2jef6zvf+DwwKh8Si8YhMKpfMpvMJjUqn1Kr1is1qt9yu9wsO
i8fksvmMTqvX7Lb7DY/L5/S6/Y7P6/f8vv8PGCg4SFhoeIiYCFUAADs=
----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/jpeg; name="201811~1.jpg"
Content-Transfer-Encoding: base64
Content-ID:

/9j/4AAQSkZJRgABAQEASABIAAD/2wBDAAEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEB
AQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQH/2wBDAQEBAQEBAQEBAQEBAQEBAQEBAQEB
AQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQH/wAARCAAiAyADAREA
AhEBAxEB/8QAFQABAQAAAAAAAAAAAAAAAAAAAAr/xAAUEAEAAAAAAAAAAAAAAAAAAAAA/8QAFAEB
AAAAAAAAAAAAAAAAAAAAAP/EABQRAQAAAAAAAAAAAAAAAAAAAAD/2gAMAwEAAhEDEQA/AL+AAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAf/9k=
----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/jpeg; name="201811~2.jpg"
Content-Transfer-Encoding: base64
Content-ID:

/9j/4AAQSkZJRgABAQEASABIAAD/2wBDAAEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEB
AQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQH/2wBDAQEBAQEBAQEBAQEBAQEBAQEBAQEB
AQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQH/wAARCAAmAR8DAREA
AhEBAxEB/8QAFQABAQAAAAAAAAAAAAAAAAAAAAr/xAAUEAEAAAAAAAAAAAAAAAAAAAAA/8QAFAEB
AAAAAAAAAAAAAAAAAAAAAP/EABQRAQAAAAAAAAAAAAAAAAAAAAD/2gAMAwEAAhEDEQA/AL+AAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAf/9k=
----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/jpeg; name="201811~3.jpg"
Content-Transfer-Encoding: base64
Content-ID:

/9j/4AAQSkZJRgABAQEASABIAAD/2wBDAAEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEB
AQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQH/2wBDAQEBAQEBAQEBAQEBAQEBAQEBAQEB
AQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQH/wAARCAAmASADAREA
AhEBAxEB/8QAFQABAQAAAAAAAAAAAAAAAAAAAAr/xAAUEAEAAAAAAAAAAAAAAAAAAAAA/8QAFAEB
AAAAAAAAAAAAAAAAAAAAAP/EABQRAQAAAAAAAAAAAAAAAAAAAAD/2gAMAwEAAhEDEQA/AL+AAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAf/9k=
----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/jpeg; name="201811~4.jpg"
Content-Transfer-Encoding: base64
Content-ID:

/9j/4AAQSkZJRgABAQEASABIAAD/2wBDAAEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEB
AQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQH/2wBDAQEBAQEBAQEBAQEBAQEBAQEBAQEB
AQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQH/wAARCAECACUDAREA
AhEBAxEB/8QAFQABAQAAAAAAAAAAAAAAAAAAAAr/xAAUEAEAAAAAAAAAAAAAAAAAAAAA/8QAFAEB
AAAAAAAAAAAAAAAAAAAAAP/EABQRAQAAAAAAAAAAAAAAAAAAAAD/2gAMAwEAAhEDEQA/ALWAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAf//Z
----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/jpeg; name="20a968~1.jpg"
Content-Transfer-Encoding: base64
Content-ID:

/9j/4AAQSkZJRgABAQEASABIAAD/2wBDAAEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEB
AQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQH/2wBDAQEBAQEBAQEBAQEBAQEBAQEBAQEB
AQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQH/wAARCAAtASwDAREA
AhEBAxEB/8QAFQABAQAAAAAAAAAAAAAAAAAAAAr/xAAUEAEAAAAAAAAAAAAAAAAAAAAA/8QAFAEB
AAAAAAAAAAAAAAAAAAAAAP/EABQRAQAAAAAAAAAAAAAAAAAAAAD/2gAMAwEAAhEDEQA/ALWAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAf/9k=

----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/jpeg; name="208eff~1.jpg"
Content-Transfer-Encoding: base64
Content-ID:

/9j/4AAQSkZJRgABAQEASABIAAD/2wBDAAEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEB
AQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQH/2wBDAQEBAQEBAQEBAQEBAQEBAQEBAQEB
AQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQH/wAARCAECAC4DAREA
AhEBAxEB/8QAFQABAQAAAAAAAAAAAAAAAAAAAAr/xAAUEAEAAAAAAAAAAAAAAAAAAAAA/8QAFAEB
AAAAAAAAAAAAAAAAAAAAAP/EABQRAQAAAAAAAAAAAAAAAAAAAAD/2gAMAwEAAhEDEQA/ALWAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAf/Z
----=_Next_7A11_20180724_EC12.0.8.2608
Content-Type: image/png; name="dola.png"
Content-Transfer-Encoding: base64
Content-ID:

iVBORw0KGgoAAAANSUhEUgAAAaEAAAECCAIAAADYQv/VAAAAAXNSR0IArs4c6QAAAARnQU1BAACx
jwv8YQUAAAAJcEhZcwAADsMAAA7DAcdvqGQAAP+lSURBVHhebP1ldB3J1q4L1o8e497b495zvrN3
gcsMYrIsssiSZdmWmRlklsWyZMvMJGa2LVnMzMzMzGYs2Ps793T36P7Z74y5VniV64sxHZ4RGZkr
KZ58ZyToh8a2zuaO7qb2Lhiclo7u5vYu5E2oR017V2Nrh6yBj5wNfmNrW1Nbe3M7Gih85KK+o6Gl
XRrX1DW1wuqb21QnCUNlS21jEwxFLAFFNkziqewjr2tqZp8dWZTNZKVcDoow2aCmsaUO64D1aW6D
1be017W01DY31za1wrB6sp5rsEooCr+tuqEFVtHQXNnYAqtqIqtubq1sbGanurmNi8hrWshHPZza
1nYYivRzzbRAOLz5mFrV1FpcW59XUZVRXP4sOy8yOS0gOvb648dOPj57TzjabNlmaGmtZ2ZuaLXO
avOWHUeOOLo6Xb53yz8yIuZl8ovM7KTsHFhiVk5cSmpAdPitp3edvN12HDlkYrNupa7OylXqahrq
Wjraurraeno6q1frGxkZGpusNjI2MDVbAzMxNTRba7TW3Bg5DDXIzS1MYKg0X2tsYW4Cs7I0s7Za
a2FpamlFDpvNOgvO19tabbCztt+wbqO9zaaNtmwOm+1gWxw2bN60fusW++3bNiHftnXjzm32DhvX
2dtY2lqarTVZbaCjqaW2Sn3F8mVLFy9c8OsvP/3M6ZvD6SeqWfDzL7/+sgDNYIt+XUj5wgUrlixe
uXTJ8sWLli1aKPIFcJYu/HXJ4oVovHzpMqze8ePHPX18bz588jQ0PPp5Wkp2aW5JTUV1Aw4Bn+ds
fNrLM1y1qOqwcVEaatrae9rau1vbulrbOmDtHT2wjo6uzs5uGBy2zs7OLk4dnZ3tqMLkLhicnq5u
GBd7u3vg94scRTmJ28NHA27JhkXBurt78RPt7Z0tre1iTchaWmlzcNZxB2SfT3Wc2MLobEfvgPF5
Dquqb65pRGUr/Mq6Jq7B+S+7ACaxz5PK65vgcwNpoqegI5BJ/zunpgW9A/2lDY7wW0U3aa9v6WjA
mrd1wdBn2VRh1drZw9bW1dve3Qfr6Onv7B3o6htk6+0bIMbxPGxcxNGCg8UhVzjCcCAbmjvqmySe
CElAGxEEu08Y7zg2FLHjxH6k3SfrVYuMoZqGRhggCNKhhinGtELOlbIGJmuYZaqT2GGooZmchLym
qUkcwmaY8nCSwytJjvBVra5RcRLgcCLnQ1LRhAOJw4njRzhDzkUmHXw5lWuQVzaTw4cQxjsBuZi3
GYzLLa9MLiyJy8wLT0p5Gh1z8+nT8z4++06eAuOMrG0MzC2N1tnabtux8+hRMM77zo2n4WHRSS+f
Z2S9zMmFJWZlx6emBMZE3Pa7d+GS644jB8C4VXq6y1esAuW0tTXBOJihoQEzzsR0NQOOGcd0M7cw
BtfgEN0E44h3Kpizsl5rvW4t5UrG2dpYrrM2t7WxsFtPmAPjQDoADlyDjxyMA+lANwYcbPsWu832
1htsLW2t15qbGhrqaetqamgsX750CXj1K6j084JfiG0/EuR++kmBOmYcYw7GmIMtXvQrow2kQw5b
uvAXAI7t1wU/M+OOnSDG3XjwyD8kIuZFempOWV5pdWVNI/q8hBSf5BJeDDLqC+LM58s/N4ODIpv0
mSYEtc5egAuMIxYJtEnGAUBdXT1gHFJ3NzELwGJmSYfRBgd5n2BcrwrXeBIbF2Ul2nRQIsCRweno
YcAhx3qiP3K3Ve2nOKtBEz7buS/IE54NXaCmvqW6Dr1GATWc/+gIsgEaYxK6Ek57SS7uKezAGGHK
ejbqDvhp+onmdrAMhvWhlRQIbmqH9hLWqjgEvKuZaDB2ALX27h5mfk8v9lYf8r7+QbbBweEf5EIF
0YiXMMYnclGEo+AXN+NZYLyPYLyD2Gd2cCUcNOOp3ICnMmWoTXMzZBQDCDxiYypV1zfAZFHVkSCT
Pk+F/x3asAR2QE/+0YraRjpU9bjsNMFQg/WprGtEDsDVoE09OKhYYdSIg0cHBtcoPmY4wOWNzeWN
TUQ6YSiWNTQhr2gC1EQbxfFWAk4JO3GAW2tbO2ACdsQ4zFtUU5dbUcOMi0hOexwZdePJkwuXL7OO
Y8aZ2NrZbt++8+jh0+7OPndvgnFRiUnP0jNUGRcUG8mM23n0oPE66xXaCsZpaqoDc/r6umAcDIwz
W0uAg8PCDblwvvlS2THgiHSWpoJx5qzpgDYYMCdIR4xbb2sJA+nAOCnowDjQjTFHgNtuv81h/Wag
cL3VOktT6LjvGAd+/Uhk+4kZR3QTidHGJqXc4oWLMJdkHBuLONJxv0IWLli2ZClAzIy7df8vjCur
rMMRR+dBb0HnkfxCDpM1bLKPSaixcVEp3yDlugVc2HrAGtAMXBNogwMaUWIRJ/HEDlmPQppxEYwb
6OmFwVetl0UYqzleGpOUqdrWTmjD+sCa0ZeV+AbjuHuyMaRQw11VdE+QjjAHgzqjYgORjjpOo0AY
ByvUoagl18NwejPL0AamyjU0QwNWZzCwha2xpRMGiklrae+h9RRGYq2zhwNNHCNWaqqGSwCIJtEG
1caA6x8Y4nxAMo71GmOLgYp1Uq7QX7afizDlPqJmYjsVykjsI+nTLGySKTD2UUktm5qqGxtBJZZy
0lAJg8OTQCvOGVtciZzr2YfxJKpsoiLOYAW2xI/Sr+NyVNcM4Y2DBwPdeJXIQQOsWG0Ty3LlOpPY
BuCALc5L6xtBpbKGRkYb003pN6IBHVScBBB0TSTlVCSe4nizoQjMVbW0Ysb8yuqc8urUgrK49NyI
l6mPIiKh45yvXNnveBqMM15nu8ZqnbGtrfWWLdsPH6RY9e5Nv4hw6DgwjmNVGGJV6LhbT+8jVt11
TMSqOnpgHMWqWlo6OloGBnqIVdesWc1oY8YJTWcoAKeIWFnEKWJVCxOgjUUcOcKYcRJzrOPYOGIF
2pCzgpNSDjlsx46NzLiNdtaScXoaGquWLEFoifCTGUdUA+V+/JF13HciTjIO7TEXyzdGG3IYxB0W
RpHqz78sWbQYaD7peNrb9/rtB4+fBoUhVk3OKQXjEKviMsadn42hJnM21frvDJMYc5ImMCg48IUZ
B9ww3WCMNoWIU0oz5BJ2AlKK6BXkgrGOQ85T0V7m39Xw0rBg/BxjDiaxixxry5vAUo47tejyZDjb
Vfq1olOj/yKHAUZMMfQLRhguz6IxGSoR26m2h2EJmEtW8q8wZxhqzW1iQKytG1ADv3j/c8iJXdra
1Qu6weBw+Mk5c02E6QQ1iba+/uH+gZHePqCNHAYc2eDADxAXMJUNplVnsQaTW87GXGOH0cBbLoyI
wIII9RW1DaAD6uEz0Xgq0wRTkXOlagOaihnFJK5HS0YPRZFYsqAVAQtt8FvCh3E9argxmVg9WqD4
OblAWHlNPWqkldcDTKgn5GFGNKBZRLzJXIOBa8jL6igvqWsAlUrrG1AJQ5GpR20amxB1CkdBPVb1
mAuYgyP0nYCgEHQwzEKMq6jNLqlMyS+NzxCxakQUGOd69eqhM+dst26HjjO0tDaysbHZtg2MO+F8
3vv29cehIdBxzzMyIeKSsnNfZGbFJqcEREXefPKAdJwyVl26bMVKtVWa2lq6utpgHEQcx6cwlmkk
2cwoIIX9nXEgmqWVGRxLCwXgYKzdOFblnEWcABxiVTZFxIocgIOCA+Ag5cA4xKoOEHq2rOP0DfW1
dNXVNVauYB1HaFPqOE7MOKYbG4qMOcwAnGFGZhwbSAf2wdCGGYdNOHrsxKUr1+48fOIXHB79PIMZ
V1kD7a8YQWZaMQK4yESAwzkbfDb0VRQxC1lrJzhCqk0ZqApMdXd29EroCIfEm8gVSCIqiaYMLI5S
paEoASdZJnN20AY5L62rQxEXI+dwVRVwvBW05ojGlGGZyClik32fGSfZJE3ZnRUSDycwcu77gFdD
M+EMy2GWwaRGwySFUpO7sa2b0KYymgafw08gjJ3OXsg0RUwqxNqg2BMUjYJo0GqwvoH+nr5eOAMC
Z5BsnA8OjcAZHB4aGhlG/gP6HpDMW8hbrgCZGIBnojEsmGtiq0jjCJ9yORVF0IHhJSppnFLWSLiI
nDFHign7ThTJqCjgJWeBA+4AfDCeBKuoqWeQwWeHpyKXRczICOOF4EfxQ1i+rCypqSutrQfgkJfV
NRB66mgN0Rj7BIqspK4e9GHAMcvgU7G2AT6mMt14Egx0E3M1FKOISjEJpGOuQdMR70jctVRRiKrA
HGMxr7yGGZeQmQ/GPQmPvPWEGHfg1BlmnJ65OTMOserxi+cu3brG43EJaelQcMm5+WBcTAox7tbT
h9BxYJyprQ0xbiXpODAOsSoYBzMyBuaUISoxztDM1BCAA8WQqzKORRwAgRwsUwSq1muh46SCA+BA
t3XWIJ35Brt1622tNtpDxNlssF9nv9GGh+QYdky6bds27Ni6YYu97YZ1FlZAqrGega6Gjpqa2vJl
qjpOJug5ilcRt/74E5MOOYxF3OLFJNmWLvmVpRzZwoUIUTGJhd4vPy1YtGiJubnZwUNHPLyvIFZl
xqXkluWX1VRUQ/i3MtG4/zMCJAjY4Rr2Fb20oxuMQw06J4os35hxnV19AA7ARfFpZ58yREWsSgoO
WGI1x5BiToFQjDlmHCMMPoxCLwZfT19fTz85wqBeZGM2AK4by5AiTpCurfUvjJNbgU0TY1MUunHc
piCAYiSKUMUsg0lsMdQQtMq4ladSe1QqlRoWJRarGM2nHSV2GvjV3E4jAG0AGcQa6Nbd3dEDroFl
3cjhA23QazDWaNgTCqUmkEY2AKSRsUobGBgYVKRhkI69IUUaGB4eHBkZgY6j1QWh+IYLciaXkmiK
SJMMlSymlFxjyhBoBCAIIiAIMCGQxLxgKIBf5TUNCA3Kqmol6cqq69hkDXJCTF0jV8p6adxAOpQL
ZvHyy6oVbXgqmcAZilwPnBVX1zGYWHBBmmH1KOcIlIr1gnqNJfhFsfIMNTEXFBzNSFYPxtUX1dQW
12KBDaWNmJ0bEBORM/jYZ00nlqCQeKzmwDiuZ8bJWPVxZOQtPz8XX9+Dp8/agHHrbA0srIxt1q/b
unX7YTDugucN38dhQZEvniekpULHpeTlJ2ZlQ8f5R0fffPzooo/n7qNHzGxt1HV1l61SozurWpo8
HodYVQSnIj4VIk6h18xNrM1NiWuAnYAaKztmHOo5OAXj1tlYAG3wlYwjs7I0hZQTas4KpAPmNtgT
5nhUDsVNG8E4ilV3b9sIxjlssIGOW2+1VjEep7Fq5dIlkGMsvsC1f/5EKg5EI87980fmmmQc5b/Q
bQfWcYS5BQuANnIWUhGEW7hQLOqnBSCnqanpgYOH3T28b91//DQkKvJ5akpuSX4ZzjGKVdHt0QOZ
ZQqECZM1yBkNMHRR+MilQbgx44SCg46DTxqKccOYY8aBbj3gUpfirgJMFWroyhJYPEmCjHMU2ZeV
MDkLG4W6CqQCuHTfg9cNW8GAU90ckAgAYjWHYJN9MI5pReJO+KrqTIE5ZZHaCIMvbn0S0bA0/Ar2
DHJ2aExNGYeKnHDWCrD39Hb19cOwrbS5UGXQaH0D8NmRRgKNEDYMmQauKVNff38/lBsMBfjIATUC
3vAwHKTR0VHoOBIUqiwD8ihqkzeP63mEnmqwedV1FNNJ5SUMjCDKwFQxxD51deCMahS0KqqqgZUS
7BpKq+pgJZW1yAWkCG0ScOyg5X9Zz+SSxkXZBgbAwbBWzCnQDWyCfIMVV9cix2qzmhNGbWCoVC3C
mFY0bx3RrQiz1zRSLnyFI8CnbEZoQy65JjHHxpjDbgfpuGVBZV1WaWVyXgkz7klUNI/HgXG223aY
2trJ8bhthw5Bx4Fxj0IDI54/e5aeJmLVnGfpGTQeFxt7++kTlyuX9hw7Ch2npq8HHYdYVUuH7qtC
xK1Zozr6pjALy7/cVeDg1MLc2NrKzMoagIPEo/E4CD1MQgNoN76dCuTBB+Mg5WS4ypizF0NyfKcV
gNvioLivunPLhh0OdtBxm22sNliutTRds0YwTn3FcqgwYAv8gm77Sag3ohvrOCSp40Ra9DMpNVAM
84Brq5Yt1VJbpaupoaa2cuXK5UuXApgQeYvQfvHixVCehw4f9/S6fPve46ehETwel1tShXOjtoF0
HHdIRgByVnAMAq75zoeDWRBkMUGUhoiVh+EoYCTR1k2xKnL0XqabFHEMLHZU4aVqqowDv1Tb8Lyy
XoVx9LswZpxYJdJxvMLIeROwLVLKKRhHNxi/+TAWd+j1jDBGG3yluFOMbrFhXta2vDN5KA01tItU
7oGCcWJkTYE2olv/EBONZVp/Pz3tQbdE+4hfRK5BhVKDMBP/D4ucoIYasIzr2ZE1TLexsTFiHI9G
wQTdaPQKJtFWWdNYVasYhhfkAr8gi0jjMLkEBajzwwFERD1DhHzkhdVQOtQYflEVyKJgHLgGQw2s
sLKmuEJRA6KVVtaUA1UQXJU1bFB/JZVoQGREDpAx+P5uPCPaMzRhYpXI8ENYEyIdmxJJvHowVCJn
BccNwK/C6hpuWYDVpmJtUXUDrLCqXuZAXmGNwkdLrimt+6bdIPGYazCOWJU3JVrQBrNgXjDupRiP
Y8bdePIEOu7A2XPrt+80sVm/2sIKsarlli1bDx48euGM+/UrD0MCmHEAHN9XjU5O9ouKErGqB2JV
s/W26vqrOVbV1tXR0dGCjjMyUgCOHhMRD4uYWYBxpNrANQ5FzS1NLQTLCG3WZiAdHBZuaABHcI1G
4kjW0Q0HS3CNGcdqjqUcGMc6bvMmuqkKEYdAddf2zTu3bdqyab095rIwNjdebaSvA8YhVl22iLAF
KokYlTAn7zkQ2qSIW0BCb8HPvyItWrJQXX3VGkM9rC0EJg0amhoZrtbX0tKCel2GRS5atHKVuo2t
3aHjZzx8rt95+NQ/LCY2MSslqyynuBpnMq7ZkDCy58OYYgwyLsqpVK8cg0Mlow3ajQFHaIN2o5Ex
klEMGtBN+IoQlTAnBtEkqpCrskzVkfUMQdUGsO+WQ4wTD6bwT1OgKpjLK8krzNsiNwdEUzGSYNKX
jAPOGHnSmHRoxgvh3YLlg2JYcks7saxVWFtPj3yqA1vDORCmvEugxFn/INAGwHFAKiimEGtSmjG8
JMuQIwmhppgEBziTCXTjNDEx8QNkCzCHgA6A47BOMI6IJh1UskoS2oe4ht6u5EItx2uK/i+YxdhC
Mb+ymosFFdUwVMoiNRAGP7+8Cg5jDnlReXVReVVxRTWssKwSNbDCMtQoGrD04yKjjduwKlRMVUJW
rhj5WLFqhaGeKQYjMaVkHNfwJAIWbR1xEBhSzCjQBuUlcwCuqLaRxJ3AH+hWUtvEDss0jmEBOM6r
WtpANx6YQxE/lFdZm1lSkZRXQoxLSn8aHYdY1fnq1f3nztns2AkdZ2S5zhid2MHBQTDOQ+g4jlVf
ZGYBcM8zMmNSUvyiIm4+eXDRx333sUPMuCUrVqqpa2rpaPN4nLExA87ETMSnQMNajk+FRgO26J4p
QMbjbsLgg2giLCWuMdSQk9kQ7ATgrKWOg8G3RzRqrxiPY9u61U4Mxm0k3m1av9HWwhb60cSQdJy6
OhjH9xwAMkCNMAfQgW9CvomoUxmuLoB+o8E4tVUrDFfrbrSz3r7FHgaYbtqwzsbG2tLS0tjYVF9/
tYaGxrIVyzV0dO02bz1yxsnj2o3bT/0DomJiX2amZpfnluBiWQ95gh4ruyv1fAgT5Y0ImEQDt+Hn
GNClEZlylMrCDcZ0o1wgBjkM/Vagh2inSEpagVwML+nDJLDggASyRjrcGDkboU1QBL/AglEyTrli
NErIjEOOrZCbQ1skuCbz74x5J6CmGGhj+QYfO4FH2XixAByMhtiEXkNOdOslrjHxeXwNewMGokGE
sWqDXmOcCXFGCcDiHPCCw6JMck06MjHR0Ab5+Pg4F+FwmhyfUjCO7yGCXxR1krIgOcNGMk0Z0BHL
ACmBAOrtBCwSZTAAgsI6QJCiRUR8hELkuFSy9JPcZGgyVcXdRuXoHo/3iXsXKoEzkVfO+B18gV0s
GWeqgB0CVQE1QVixbgRTcJZRy5MKqqphUGeAF6ywEvCtEtrzv2CccAQllapNGujGgGMRV1CtFHRV
9QBcWX0LcjIRsaoaSznOwTjU4LdyK2rSSsrBOMSq4Ylp/lEKxu07e1bJOGswznzzZmYcdNyDYH8w
DjoOgIOBdHFpaYGx0bf9iHF7TxyxsN8Axi1evmqlhibfV+WXHJhxjDZgDmgD4IA2K0tTGyszGN9D
gHyjXPCOAcdoY4dzWzEAx8EpM46NbrButIFJwNFTI1sh4jZCx8FHjb2NOXQcYlVDXS0dDfVVCDCX
LAK/RFyqYBwAt0CYgm4//0J0W7Ro6fJlGhpqRmv011tb7Nq6ee+Orbu3OWzbbO+weQOSjc16c4t1
JqYWBqvXaOsbrDGz2LZ7/2l39yt3790PDAiKiU1IzUrLF8/HVdeLWOxbZAqjIE5pjAOuh4/OTN1b
OJJxEm3MFPRnGBAjVZVQbwrGSTaxSa5JA63Y5KTvGnA9Gki6Ie/tVdANxmzFFKwMqcu272NVNt4i
dpBjJ4BoaMPNeEuZccIUHGQHpohMxRLQWAE40E3cRqBoFJsvjOkmVlzxLBtBbhDajTQamMWAU6WY
uF2gkGbIZUKR28gikgJmo2OwCcBN6UyOT0xNTML5Ab1axJuKAXLWLLKfq0geGr2CcXtxr5AgJUYo
RXDe2trYTjfdseNgvM3YES0d2AvYd4pxCj4VZLG1s6Otq7O9u6u9UzwUjiOkVPu4EGJSWxd2n2jf
jUsE2pMP43peclMbzkV6pQwHAIcKBjjyPRPgFWsrN4o2p6YOUWdeRRUst7wSOYowZiJvuNxq5Nhw
5Iyz/AqFQ4yrVog4KDhVxiEH2ljKcY4dC6LBRNBKT5Mw6ZSxKgk96LiM4nIRqxZEvswIiI6n8bir
Vw+eO2+3E7GqrYG5xRora8vNmzcfOHDw/CnXqz73Ap+GJcTHpSRDwcH4noMq4yw32oNxy1ZpMOP4
Ra41a1YrGGduxENsyAE7wTvkRtYWJiIyJdLZ0B0GGmuT8SlxTUSmjLn1YvSNK8E4BebsrDbYr+P7
qvx83KaN64XUstu5zZ5j1a2ot1u3wcrUyph0nI76SoiyJUsWAWGIQ5lxhDoATsSn0HFMtyXLli5f
uUJDS1Nnta6JiYmd7fqd23fs3rlrx7bt27Zs37Z956aNW23Xb7Sysbew2WBmZWtmZWO70WH/kRMX
vbyv33/4KCg0NP7Z8/S8jMKq/Ao6k/m+Kpvs80w3roSPHN1YMVUZl5GCa+tWvk6giFLBNWmAjjKn
KBUYIhKpCDFV/+8m28BhYx+5NAg9bsyJGYcfRa7oRMg7CMTfSKS8Z8IbCEcat0EO45bIuZKNtRvJ
N0zq6kVOjnKgjQ10g3yj1RfMxcpwNIqwtH9giIJT/P8t9YFnABwSw0sAjmDHFENikEGaqTpgGhzw
i2x8dHxsBDCDA4PDPvIpqLjJ8R9EN1ZIGCKdCD/BMqg2UEy8ckGPyIlrHRkjBnwBZXCMiEoglFDK
YvyBDis7MBx6cQK041rT2dkO66Lngzpw1KWvUkk3wLEYGI4kX6rowIlJqoaDz8cfxj4M9VDo4qTq
5Z+mnySMEhZxREHAuraO2tZ2bBE2rZweH1HQHLQC72BQfAw4UI9zIfeIZWgDxjHgyER8ynQjwNU2
AmeMORihTRiNytW3IAfUpI4D7EA3Zlx5o7ivWlmbXlQGHZeQWQjGBcYk3Hzi53Ll6pHz5zfu2WO2
3g6MM7S0Mt+4ceO+ffvOnHC+cgmMC42Pi05KTEhLZ8wR46Kj7vg/9rjuc+DUceg4zdVrwLgV6hrM
uDWGBiYm9Ewc32dYa25sakLDc0Yma9YYGxqbGpmYIcgzMjDUNzDURTMrazMbW/GSFshlrQhXEZYi
DmW0bbAnh33QjQfggDbCnJ21oBs9NbJ5E724ChEHxu3Zvmn3DmIc3Vq1NLc0Wm1soAvGaaxcQe+r
LlwIxrGIozsLv/yiiExBtyVLli1btnz5cjU1NR0dHawiwmz7DQ7btu7avm3Plq27HLbs3Oyww37L
jg0OO9dv2r5u4zbbzTvWbYZ03HPk7HnPq9dvPfR/GhYbnZielFOUXVJdXEVPAqCfy27M3RtGZ8tf
xR37MG7Mz511tNNrDDwSh5wZh1MfhrNQmhBZlOAwrRhhOMEVhBLA4kqeyiaLhCsl1LiGi/Dxk0jo
JMjxE1gBXgesEtaH1qodpOuldVY+iYZNkA5y1Rpuw72bfa4ExdioRug1WQPj+6TIsRFsWHcOS6Ha
+EE2EZ7SjQImGrOM0QaQCb4pAMdoA8LYkURTyDSATFAMXAPImGLsMNqmpyZgXM8+6ThElOjwiBnB
MnGZ+kYxfhIPyMCKij1IiZxe8nHMGDqAC+lTAR1FDYjW1drV3Yb9jBx7rKuzpae7rae7HYZJ3V1t
MPjd5Ld297QLhUvW29eJPdbXTzk9LiNq+vtAvY6+3k7YQH83inCQwx8a7Bkc6B7oJ39woAf5cH9P
P9WQDQ9hB9NJBm2MrWAIwnDaYBshrbHJAB+IwzIWaGMFx0GuCGwJbWAcEAaDQwpOyTjGHHKmG2OO
FRzDDj6R7q/hqrznwM/HYYEZxZXMuIik9KDY+Nt+Aa6+145euLBp714wTn+tOTAHxtnt3r3b8egF
b4/bfo+CY2PAuGfpGQAc8uikl8w4V1+v/Y7HoOPAuKUrV4Fx4p18XTDO1NTYyNhgjZGeidmadbaW
O3duP3z00PHzZ857uHtfu3blzu1LN65f8PQ4fPrk1l3bLK3XGom3981M11ibm4JlABzCUhGZWpNt
WMdP/IJiPBIHxtltsIaIcwDdFK9zEeO2iWG47dvt9+zcLB4Dtgfj7K3MrU3W0D0HTTX1ZTQex/cT
GG0LFv4K5C1cvGjxUqLbihUrViGtWKmtqWWgr7va0MTMcp3tBgf7zTs3b9+7YetuEM0eRNu+f8PW
vXbb9trt2Ldpz6GtB47sOXbirLvH5Tu37wUGB8Y8T0jPxeUEl6uK2kYWMqKXkgZR7bcw9Gfu/LKr
Sx+AIx3HF3DxiIZ4SgOnvfI639PHvsCcIpGQU9Fo7DC2mFlSl0mHJ6m2Z+MizSUSBcPix5AU6yAe
LsO6QcfxeJxcf2watgsGB/XsqBq6vOi0tFuQYxYh0PoVDVDJNxNE52TAMdooFMU6dg+IB/vEG6OC
bvT/QB/CU6aYJBpyUIxzTlKvjQ5/U3DEuJFRYI1oppRsLNOQT6IWPrg2NQECoghnenoSRg4YV99O
oTWhV+gv3k2gCfYyOWJHgjI4Dtjr2N8MMtSASjDBL4WJULK1vaO5o725s6OlqxNcQzCqKHINim3t
jWxgKaRhe1sTJqFNR3tTXzfA19rb0w7r72lHEQZnoLdjoLdtsK9zqL+LrLdzeKAbzshg1+hQL9vY
cN/E6AD7I8N9sPGRfjZMUjQbGRgZ7h8ewlTKYUPDtOtxAPiuDvYAfUOlnT4TQo/C1deXVDcCQHnl
NcQ1Ea7CiHR1ChGHPL+2oaC2uagWXKNhOBCNScdSjq28oVWMzUHB0UicoBuRDozDVGAUjHuRU5SQ
mQ8d5xcXd9vf3/36dWLc7j2mtuvBuNVWVmvt7e1379578uS5Sy43nzwIiIrm17nAuPjUtOikZGKc
3z33q577HY9YbLLXMDJargaNpKmtq2W4Wsdwtb6enoHpWrMdWzeePHHYw8v9xp3bDwL9QiEH09Nz
CopLy6qLy6tKKqrzi8tepKY+Cg5y8fHae3j/ug02YKKxiQHCWAi6jeuBNjZ6nwFco/cWBOP4aTjx
QJzilVV6vWHbxi1b7XcgSt25CYxDrLp9Mz8GvNbKzAiM09NUQ6wKHbd4IRTbIpAN+eLFi4V2W7J0
+bIVq1ZCvmmoaSLq1tbRg4gzWGNmbG611naDzabtABygtn7rPuLaroP2O/Zv3Hlg676jOw+cOHD8
nOMFN5fLvtcePXoSHhmVlMoiDiFLbVNbcxuduFJ38EmAeAqG7soIYlhw6IeW7EuVBLSRL0iHGmrW
QTIKoAHwVNGDhEUwm5hrqg5yNvoN0UZWsoOcuqTgHRw5lTAnSCf1BzMO68nGaytXr406oeioTK5O
bJHyzoDYDzDVonRYgDDRYCwYhc4hvfbNlG8gKB/+UAy3cWKuScyBX9+gJobeeDQNJqEmFBv5AlmT
BDUl46SxcGPVxjYzPQnjyh9oAJD3tFg5Upe94rrRB0x3MshISfWQsfhSwovA1NLaID72Uc9vvsNp
bKptaKxB3thQ01BPL5jW4JJZVwmrqi6rrCqtrCqpwjlWV1ZVXVxRWYxidU1ZXX1lQ2M1cpqxqRaL
xcJbWxraWhuZjyAggw+8A+yQw4eDHLBjhDH42OCPDPaAbmAc2AebHBucnhiGzUyOyHx2anRqbHhq
ErsM0nd4DJePEToA0NUQhNgFzZ2dtW30KREQCiQC7PIq6/OqGwurFHdRYWCfQsFViXupdc0ossFn
xlHESvdY60vraXiOMQcD9TAjAJpZUpWYW8yMexoby4w75uQEHQfG6ZmtNbC0BOM27Nq1z9ERjLvx
+D4YF5X4Ii4lVTwclxzzMjkoJvqO/0Pny257Tx6FjtM2WrNcTVNdne856BqsXmO3afOZM6d8Lrvd
unc3Mu5ZclZBblk11gdRPGIQ6HcKzZraGhqbYTiE5bXVmfm5UQkxtx7cOeJ4bP3mDSYWpmug7NYa
0WNxduL+6ab1MGg3KDjmGuLTjZtsNzvYAXZbHOy3bd0EHbd7hwMMjNu1fTN0HFSenc1aK3NjIwNd
fW0NLQ1N9VVqCEUh2ZhuK1YsgwFtK8A3DWwDNkJfW8dAQ0dfR99Eb7WZoamFic16i41b7Lbt37B9
n+2W3Ru2wjmwec9RhwPHYNuPOB4973rew8fn9l2IuJD4FxBxaYXluEpVNbWyRhPEQC+k5xWGh0cR
KvHLQOQMDInBcXqAHr2WCfh39sHgEwUYLkQ3CnLwD4AjaSfQI4IeogVMgQ1BLna4C8p6noR8oA8B
FPmYxGiTJpuBXkRQkfCL+BGIKV4xuYaMLS4y77A8YYrQEjnvCuY7O1wvfkqx1aqmOgsbCTeBNnFH
gcbdgDOmGw+4Se2GBKgBcHCYdJzAMgXgeHBNMA7Gko1zwAvkYrpJn9EG4xp2Zmem4PwwAPLyDgba
KBKkeJBGxjpJdrEEg9pikNFL7g11QJgAVml5RVFRcW5hSXZBcVZ+QUZBYWZhUVZBYXZ+QVZuXkZu
XhosryA5OzcxJy8pN/9lVs4LOPRuZfYz+FzML0wrKsksKc0trciHYZlYMgzgq60DHMnqG6pgTc21
zS11La31rW0NkIHtHU0wrCekH6JgKfdgw33EQdZ9jD9WecDczDhINzgzOSTyETBubnpsfmacbW5q
fHZybGZiFDY9PjYxAsWMc76vewDashuat7KRlBrkG5GukmJYYpwIZpl0bMw1yTiFI+7q0EsR/I6X
kHIwLAG9Lqu0+mV+6fPswqjkzCcxMWCc27VrR86f51gVjFttYWlqR58e2XPiBOs4/8io8GcJkHLA
XHxqSmzyS7+I8FtPHzr7ejLjNFYbrNTQXqUOlaSlb2S2/8iBK17u9+7dexoXkVxYWNPW0T+Ek2Z2
dmJmbmoa58PExATOOZypUDcNrR21TfSpq9aWpt4OGnaorq1KSk+++eTOcafT9ju2mllaGBuvsTAF
7Czota1NtjAAzsF+/ZaNdps32G7bbA8D47Zs3bgNXNu2iaUccsStoCF03zrrtQiETYzXGBgYaGtr
q4u0cuVKRKagG/mroEO1oURpTFHbQEN3zUrt1Ro6ppq6JlprzI2sbcxsN1rY77DatMvSYfeGXce2
HnXac9b9wEXPvedd9551cXTzdrpy7fojv6cRMVFJ6UnZJWA6RFx9SwfCLvRbHicivIkuhwSHRn2U
PZD1BXVQkcA+dFcmIBt6NIw6OYRB37fRN2YcEheRVCeBWTB0NIU+VGEfO8wvVa5xN+V6ztlorm9L
hktPq8B4wWwIHsVLZgrSKX+TnlYjUmFhBEbMShIMbEIiLSZ8WqJI2DpmvWJ7aTK9USUq6GFdMgXa
FNoNeww50MbjbJJxqnubc0Sn2N+MNuKa8gaCFGgCaiOszmCMMKYYE006qETOztzs9A99fW2AmhgX
ozgRkWNrWyNwVt9YU1VTXl5ZUlKaX1iUA4Rl56SkZTzLyEhAYJScEpX0MuxFYkjCs8D454EJL4Ke
JQYnJoclpYS/TIlKTo2GpaTFZObEg2g5eYkgXX5hSl7By/zC5ILC5MKilMLi1NLyzLKK7MrqPB7i
r6krFk+SVTQ2VUlrbq5uaakha61tgt9a29oGzFEOzdHV3dzd3YxN6Olp6e1tFfEs8hbkg31QeZB4
HcMDnQhpx4Z7JkaBub6pcZCuH4CDgxyMk4B7NTvxem4S9nZuGvZ6ZhI2P0Xgg9CbmMQVZxhHsauv
H+KuvKmloLo2v6oGvOOIlY3UnGBccR2hTfKO7K9vPqgyjsbjBOOg4yKS0h9Hxtz1D/C4cePYhYsb
d++FWtE1Xau/1gKMW7d9+45jx854uFx/dM8/MiLi+bPYZNCNABf54rlfFH13xNXXa+/J48Q4Q3o+
buFKdVMri3OnD9+6fjkgOjyjuLStcwin0ez03Js3796+R/b63Ye379+/f/v27Zs3b169ejU9PYvg
YHhkjPpAd+dgL414UtQ/iKt8Z0NTfXJO5t1A/5PuLht3O5hampibrLG1XLvBhl5W3bSRbqRCxDmI
b2TCEKhu274JOTC3e9dWMA7go3sRDnZ2G9ZZWVlYWKw1NTU2MNCjJ5V1CGfqGlqr1LRAtxUa2is1
dVdo6CAH3VZoGSzX1F+uuVpN30httanWGjM9YwudtbZrNmzbfOT8Ya9bp24EnrsT7Ho/xONBsPsd
P887j71uP7zxNPgptGhqbmp+BXZ1NSKEDmBG8cgC+highgTET04iIppCrupwoh6pbKlKPU6iR1MS
fAAIKDEXOAcpkDOJCEkCcIwq5o00BhkM9dKXk0A6hp2CUpgqFotlchIjgAoDnZCjFYybs8rjShxc
4An/E8AG6UV3JpRMcos4l1NlpUwoYk8qCspbCki8owAwIpxIcjcixyQ42O1QayTYxB1SoI31mgQc
5zPT1A2/AxwzjokGh6EG4yLX/NDe2YIYs66+CkQrLCvIKcyCsMrOTHiZHPnseVBM7OOI8NvhYTfD
Qm8EBfoGBV6NiLobl/A4Nv5R/LMnz18EgmsvUyNAtKxswIt0XHFJDmmxqqLq6uL6+nL6SFJTDSQY
THzbra6tra6rqwlsYpN46u9phYFKMDHQhsBT4SNnYMGAMBhha7B7dKBrfKQXBoTBMAvn0tCMF4U2
QBsDTkk3hKtD8zMKHQe0cQ7SMezezE+9ez3z/tUs7A2QN4sdir2G/Y7r/Gjf0GBrd3dNSxuAReN0
VXUgHWjFqo2H6vjBYBmuwphx4rYD3XmAwWcdlybG4+LSc2k8Lib+TkCA582bJy4CIsQ4HRMzPTNz
o3W21tu2bTty9LS7s+/921Bt0HGgGwWqicy4MOgsFx+PvcePmW/cuNJA75flS8ys1p49e+zmLd/o
lymVLV3DIxOvXs29e/fm3bt34NqHDx+Atncf3r//+AH5m7fv37378AFT3r1583p+bm4OJ8vY+CQu
s7g4Q/IPDtDHVXsoIOuqrq9Lzcu+H+R30uWC/a4tppZmdHfCysxuvdWmTescHES46rB+89YNDtsI
cIhS9+zetnvXNsg6iDuHLfZ29uvX2dqYW1qYmpoaGRnprzbQ0dVHNKqurUdQE7ZCQ2+Jmt4SDd1l
WquXaemvoEn6yzR1luvoLdMzWqZvrmW1dcspj7N3Qn1Ckm9E59yKzr4bk/EgOu1+ZPKt4NgbgZF3
Q6ID4hPjMwoziqpxFCBRO3roK2PohOh+6GZA2LQyzczMzIoEBwl7gItAHhIaIBfdkoCIjoolIOcO
LDszliy7uoQCYMSJmIJdKagnEzhFwazKvVeYxB8zEc73ak6JTuRUoETjYoRSZSX+Z9hRuC0MideB
JRi/zM7ryYnXHw14Ehe5Afuc0AC53EZ2kOBgJwBhvCuQ002EEVxOwLhvIg6xqWAc3TcgmxhhhHHs
yb50GGdwGHDsw5HGpPt7zQ+ZmUmpqbGxCU/Dwu+GBF8PCvDxf+rx+LFrwBN3/8dugU89Av29goOv
hARfC4u4jWYvkiIQY4KDpeU5lVVFNbVQXhBcNQgb+bZpb0/H4EDP0GDvMI3x9yNO5BExihMnR6bG
h+AgnxhHtDgMvkBJccwIezU9rho5gjU8FYbGFGaODSCfmxyenxqBof2bWWITz4X2vEAxF0WjDDXm
GpsIUYdgc9MjANyrWcw4+npO8YvgGtPt7atpzmEg3ds3s+/eziF/83r21TwuFJMIaXEkhkdHuvuH
Gjq6QStADaT7JuhqG0vqm6Hm+Hlg1nQcsZbRq10KxjEi6dmRkiqp4/xiYm/5+SFWPebkBMaZ2tpB
xMHWWNtYbtnqcPDQKbeLYNyTsFC+tQrMgXHg3ZPwwJuPbzt5ue4+emTNunVLtDXNbG0uXDh54+61
mKyslr4BxKREtHdvgDYAjnEG2L0lGfcRzrv3H6HtuM3bt6+pBt6bd29evZ+fnUOvxpUYZzY6HGKg
LrqFRpFRbXNzUm72Df8nh8+dstsGZWe21oxgJ56Vs9nksGHzFopYt+9w2Lljy/btW7duddiyZfPm
LZvs7DdYr7czt7Y1NbM0MbXQMzTW1jfU0DVQA8h0CGdQcMvV9JdpGCzVFJgD2tS1l6rrLtPQQ80C
HTN1mwNbz91090+8FVcQllb/LL81Ia8lKqMm+GVxwIu8J/GZj2OTH8ckhiamx2cWZZfW4XCAcUAH
AikGHGgFloFiwBknKFl25ueJ8pxkG+TwJRCZfUjYOZxjgaxTkJh6nKO3s+KDwwk4II6IHARCgsOg
QhqAYmOQ/Y137JAJxmEuXgKK0uFJ0kGiSeJugADRN+UFByuGJGuwtkhcw0k2kIlnlAlF2UbOzg5B
bXSYNRqMHDHuRsNtyoAUxoxjMMG4EiyDz8CS2ILJepjUblzDxfm5GfZ/CHjg/vS+0/3bpx7eOf3k
7ln/h85PH3v4BV0Jj7ofE+/3PDEsOTUmMzsRsSqC1qrqsvq6qtaWBgS2w/00og+ETYwMTo8rBrYk
a5g7MNZEb+empL2bRyRIEkmBDyVHSDS9mf3wZv7967nv7N2rWWAFcJkXAGISvX4F9Myh/ce3rz69
e80ON347PyObcc6rxOsmDCs2BrTB3sxPwDCJG2Mqcl4rdt5gxd7Nf/j45sP717B3b+dBOvwQlB30
M65CI2OjCGBrW9tLGuhpXpAOaAPgJOyoKHQcGCdiVRGTNxHjYNBxmCu1iN7lepZVAMb5x8bdCghw
uXbt6MWLm/ftM7GxhYjTN7c0tllvvW07GHfc9QIzLiQuFoyLSUqMSkwixoUGXb1385ynq8P+/Qbm
a603rD974cTt+/fSCos7BoZfzdHKU0j6nqAm7C0gB0MC5JBIwYmgFYkrIe7ICHVvYa9fv56Zm8UJ
iys8+gw9wt3ZAdrBWlo7y6pq45NTr96/t9/xmO2WTWstzM3MTGxtrB02b9zssAHCbeu2TQ4Omxy2
btnkQO8l2G3abG230XzdelPzdWtMLHQNTbQNjNT1DVfpGsAQnK7SMliqDsbpLdXSWaKutXiF+q/L
NX7VMFiss3aZ4QbN9Ye2Xbh/8SEAVxSR1fSysCOjtC2rvCOtrC0htzY8rTT4ZUFAYrZfQlpwYnpC
dlFuRV11E72PBXSgS6L7AUngFFjG/MLWIYFxSHAQucscNWiGxJPkLEw9JIYgEms95p1MDD4k7vMy
ochcQILD9EEiaInEtx3YJ1AJ5MkEfnGOKcgVSlCZ4HMR80okEcOET/gRSbEqIimlFiGJjG8BKB9S
I2oPj6CC8c1bJOZS6Fkp05CzcMN09BGBsL88mku8U95MgEm9Buc7Y5CxowoyrmdfFoE2+Ggja354
8sQtwP9ycNCNiMj7cQlBSSmxaZmJ+bjglRXU1tFdzubmRpzG/DDayHAfJBhUleQX7P2rGWDr3Txy
iuyAGBgQAOjAYRLB0LvYASCYTQp7//rjhzfv371CjmhJ6SiAwlORox6GhTDLuEa0lA4Z+5jKP4fV
QGNq/4aKPDuMYApd9moaDtiqYJnAItMNvFPUCxxjRixZsQT89AdaAap8M/t2bmJeBLDQdO29vaUN
LeAaB6rIQTrJOH4YGIyj50Xq6lnKKWLVqjowLjGXdBy95xAXfycoiBkHWon7quZ6QseZb3YA445c
PHv53q3HoSFgHNAW9eJ5+ItnofFxj4IDrty7cdjpHELarfv2OrtevP/odmpB0cDo5PvXr95jX334
9P7d548UoSoCVSSimhBxEG5cSQGrknrv374jwz/RkIJcAh31+dn5GZy+g8NDQHybePOkswsdrr+j
s7uwsjr6RdKV23cPOp4Eak0sTC0s1q6ztrTbsG7DRjswzm7TRlt64Wuzpa29mY2dmZWNoamFrrGZ
lqGxup6Rmu6aVTpGK7QMhXzTX6Sm/esqtQXLVy1Ysmqhmv6S1VZqlrv1tzhtOf3Q6W7s9cicwNT6
xIL2tLLWjLLGrLKm7Mq29JKW+Nzq6Mzy0OT8wBfZIUkZz3KKwbiK+tbmDrrXgE6OWIm1GDgFZtFW
CaIx1JCY9Ujs8yROqCEQCt6xg8TLQZK8g4OEX2H2ITHyQEDQgX2BBkVSJQ7zCPnwoMJh0iFJfjHp
6CaGSKhnR05lwCEHNyVMmVPIQTFGjHgugy7YcEQsTiQSiAF9vgEIyGAfEGFayUmiscJHK1GkfsGD
aN8mqWg0ODwXHF6yqomWaKNoxm3Y5IzwmWis2uBwkWvgw37IyEwuLBIjaNWlDY01He3NXZ0tPMCs
+rAF6bKp8Vczk8AZej6DDEb4eDtHBnAIBhEL3lEOCnz6iM5CbGL6UCXU0Mc3Hz+9haHLcRtMRf7p
8ztRj6lkHz6+/vQZlWTwP396JxEmZ0H7z1/e84zK2ZWVnz7wb9GvIPx6Tz0ckz7AUa4eFsLLhIFf
jDBhc4AX448NUk42kO0VuBTK8c0c9iwuTcO9/X3Vza2gW15lfVG1CFHrmkA9OTDHD5Ew3bgGk3Kq
SMeBcfEZpOOeRsfdCwhyv3nrmLOzw74DZus3EOPMzOlVB/tNm/bvP37xgs+daw9D/BCrhj97HvU8
MTz+WVBczIOQAM+bVw+cOg4Z5XrZ8+6jO6n5Bf3DIwg6P7yBZFMQDfkn2kHfikQvkdhnwAnqURBL
wBM1KHIlJ/bRydG30Wkpcu/tQQAL66AP3PY0tnbklVUExcU5X/bdffSYxYZ1+kYGJqZrrdfZ2q7f
AMZZb9iw1tbOxGb9GgsrAzNzbWNTjdUmavomarrGABzk28JVWr8s1/x5yaoFS5f+uHjZolUGK402
6G4+brL/0qZTD49fjvEKSH+UUBKd0ZRU0Ar5ll4BEdcKxmVUNieXNsfm1IanlAQl5kSl5D/PLcmv
aqhpaW/p7Onto0gNGoXpAyoxpLAtSLxpvL3AGW2qSFypOgmNOeckfV4a8w4JNciZgFL3scPg4wTe
gS5IcEBABYZGx6bGxlW1HhJrPU7gF5JEG/uScbKS4QhWYnaQFAunmFEEjxI90mSgx8hgfCCXJovc
RjbDjOygRk6VNVwJQw0XuYYdVMp6bsaTuL3qQnj1uPj3VZV0Y/uht6cdRKMnZscGJ5QajeK1WQow
odE+vJ5lgUYabX4GYSA6tuzqJGpEDnYo8CGYwvz68vk9swk5OYJEANA3GH16x20oF7TiBgws1Rq0
IQ4KrmH5qPzy9QPVf/5I+Zf3iqL0P39EL5azI+cZmWswLIpWifEqoKlqvHUwHonj7UUuMPfNMJUk
oZCWmISAGnu5b2iwurWNg1boOA5aeTyOw1UinXjhgeJW8TBddmUNGCfG4wrDE9PAuDt+AWDcURdn
oePsdE3X6pqZG1mvs9hIr6weuUifOwfjAmMiIN8iEp6HJcQHRUfc8nvk5ON50cf95v3bT4P8knOy
+0ZGXr95B9EG+ygS+ieS4Bsl+KhkB71X+rIGDnJ0aS7KJHo9dXsknoSePDtP9yiGRoY7+8X76u3o
Yn2tnT21TW05JWVh8THnfXxsd+5abWmtvcZ4tampqZWVkaX1Ggtr4BsQ1zYx01hjukqPHhBZoqaz
cIXmr0s0fl2i9fOiZT+tWPGL1upV5ltXO5yxPnRt+5mnh7xCL9xP8g0vfPy8FoxLzG9JL2/PqurK
KG3NqmjNrGpJKWuKy60OTy0MSc6KSslNyivDgahubsP69A8QLKCbQBboLMYQqCQ3CluExL7cFShy
PSeeqpq4EqTjhBqF91+xj32QDonlHrMPjoJ3COUmJsVTExQSstDjxJxCAvUYW8iZd8wy2u9KBScZ
x0zELJJxjDlWVayVAAUw4s3r+VfzszDmBZzXr+Y4Z4ebsQ8HBkc240nSZEtZIxvLIi+Bi/h1LsrF
wuFfZOMayTjkjDau/M7/AVDjQXoejeJgDcoFLINCIVP2dlWjPi9kERtjQkEKwSbGCvEFoPlIqkoB
HeHAvv5GJsH0jVCY9PUzt/nyhdQG+4qpwrBYtMfs5Hz5xLPAIfv6gQ0zcg2mol/zysipciVp5VkG
ivUH9djkFjEWscmC4wA6YCeE3gfsB3KEKYTh2zevsPcg6BSYq6kvrFE8REJRqtLKG1orGumLI2Ac
AlU5Hvcipygmlb47EhD3DIxzvX79iJPTxj17wDgd07U8Hme5ZevGffuZcQ+Cn4JxkHJh8XGhcdF+
kaE3Ht/3vX/zSZCfX0gQANc/MIKORnQTTHv/keQbU4wT+8jZ4Y7KvmpCJXovHNmrZU/mbs9FngQH
nRl9dWJianBopLO3p6mD3vdsa6fPebe0tkNaPgwPP3/J037nDi0zsxV6hhr6prqmZjompppGJiv1
DCDfFq/S/mW5+s8r1H9duvLXpSt+WbFykZ6xmuVek90eG0492O0SeuxSnOP1BKdHaVfDyx4/rwvP
bIzLb0oq7kSIml3RkVfTmVXVnljUgFg15GVBSFJ2ZHJOalEVM669Gz1+kEeTID+xqqAMcMObwNsI
nzCmTLyZvDfgoIH0uV46tAuUiGQHOe8oOLyjsH/gMPK+gx0cAbpvNzcQw5FAUY7xsQPMseJj9iGw
VUUe8w5J4I4SfFkpGTc2OiwHyFQBB5N8YdghhzGA6CQXxjDiHMV3b19zM+nIlrwEnpfr3797wz7P
zsaN2eEcU9mwBM5VjdcQhtXmIox5x5iDD/tBjsoDaoi5KEZ7Ny8U2Svq4ejYIuKDKaBGYzqvGA2q
xFFlGQw1CoQxof5qTDHJIDb431ClNF6gKrBUTdZ8N+N3U9nkQmC8WKwh1p9WUsCON4c3jSthiJRR
IwWgIB3RDftBSlfGnCAgjvQcrhDTM+Pdg4OlDU0IjsR4XANCVEk6+MAcDIyDpiusUnxbCYyLTcuT
Os7z5s2TLi7QcWs3bDQwtwTjDK3W8Xjc0YsXPW/43g/yC46LComLDY2LhYh7EOz/JDwwPCYsNDry
WXpGR+8AThKiGys4cYQ4oSvKnB1O6JAyRz33T27Aldxp4XCP5QT/7wn1799+wEmLjjo2Md4zMAjS
NbbTi8nD/X3D/QNd/d0Zxfm3/f33nTyja26zSFt7gZrar6vUl2hqL1bXWaSmvWilzsKlmgDcrys1
F+uv1bA5ZLbLZ+PpJ/u8IhyvvjhzM/X07TSnx9m+YcUP4qv8k+tD0+ujsppfFDSlV3QhYpWA84/P
CHyeEZUKxlVgb0NRtnX1QsehpzPjQBMGDaADAEkeYUulg5x3AheR5P5BzpOQ5L6Cwz4X5Vxw5DI5
0c4SiX9agk+yj31IPRgc7E8mHegHrQefI1yQDpvDA3mcGHmqCZhDrohVR+mtnonx4e9EnIQFDL6k
jCqJQDHO+QEj+HA+vH+LGq6UDaRxEW0wlRuzg3qe9HdHTpU1yLEmyHlNeK0Yc/B5heX6S+cHHlRC
qPXpHXVRdFSSLR9omAwmRQ07Iq78i0wj6n16S7BQYkXVuObvk2RRVbLJSapEYwc1TDGcV6qNJSul
ozqJZ5EOc41z2Uz6zDUYb5fcQB4QVBSlVlXhHWOOqUe8e0978s3cNE6i+vYuaLSC6nowjmNVAE6G
qxSxirsQrOPE83ElYJy4r5pwLyDo0s1bp9zcth06ZGG/ie6rinsOFg5bNh86dPjChUu3rj0I9POP
CguJjwbg/CPCQ2KjEl4+j0qIS0hLb+nswanFgSn3NGw/9tGnD9/QhknsIMlK0fZbkrOrOkjopdxd
OXH/RPpWFBNFHdIrnI8TU5PDoyN9fT2d3R1dPZ0D/b0jA6QvqhoaIl88d75yZcOePcsNDf+xfMU/
F69YsEwdgerCFdqL1HRXGa7Xtjtqst9r49nHezwjj1x9du5m+sX7OU73sp3uZ7g9ybwSVnAnvvLB
88qgl1UhabUhadUBSSWP4zLvR7+8GxF/PyI+6FlKbEY+M66uuZ0Zh24ONIARoAZQwnBBzpvGm4nE
W801nMudwI7MZfov96SsEbMqFoVK9sVu+zYaAJ+BCwc5fMANGRyh9kjuMe9I6ImEDWHecZISj5Ok
nswh32BgHHIGHLQPGMdcYGNksDFQkLMDYwwxehhbMHHbkOAla9iRRfbRTDyO+a2BqoNlcpENRTYm
nazBOqCGK5HzSsKR6wkjxqFDwj6/x9KJbujDpFlk+Cl6O0sbRhuMiKAkhQQHo0RChLECRzbjBlwv
fRg34HpuD+N6dlRnly3ZUa3h34Vxze+/f4XDS5Aml/nbb19gcGQbuRw2VCoWyJuslHVyhJH3lUCe
gnSf6OGSV2/f0yTE+FNTE529AyV1dM+UnpUTX15iwKmSDuBT6Dj67kgZuiJ0nF9M/N2AIK8bN0+7
uu08fMRqk4Pq83GbDxw46nzB6+bVuwGPEJ8GREO8hUbGxyelJ0c/i49KTGpq78IJwIBDD1HtYGAc
9hSKnKsmboYOxpO4PS1CJPaRcw9ETuwSiXqn6IrUO5VTuYapgf9hcFDEtRWwGxga7Oxsb2lpamlr
7u7uHB4agLIrrazwj4485upisnHjQi3d//PXZf99qfoSQxudDY6Wh29sOv9ot0fYgSvPjl9PPn8n
0+lhzoUH2U73ss7cSj55K/HsgyTnp0k+oWnewSnuT+Oc7wY73/Zzu/vk0sOnd0Mig58nJ2QXZZRW
Y2/Lt7jAOCTgAJoIvMC68dqKrVHghjeZt52TapEdrkHCfuMk9x47qOEcRTH9E8+OJFp9v5P5d9nh
lRG7WZFkUa6zUHmKBOox+LBRSMw7Zh9FtiKBfUjTk4o7pKqAkwZeMOMk7BgZTDcmCww1jBs2iSTm
F3LEdgqcIeeYAhRT8dm4hk1W4hSTU2VjyT44WAH5ozBeMV4TxhwXfwDaFDj7+JY7sGDcG9WOzf6n
Lx8/f1WQhY1ZgBwHETlqGByqk7he5lwvfbSXlWxchDFi5NJgqktALn9LdSHsqE7luXgNYbJSTuK5
VH12VH3Mrkp5ceeXBCwVhc5l6pGyI9JhL8/jROkdHChraGTGMdrQx8A1yDdpzD5mXGJuKTMOOu5O
ULD37btgHHScIlZda2Fgbb1u61b6FLAz/WmuB8FPn0aE+EeEQrslZaXGPX8W/uJZTWMLjjIEGy77
MzN0uxNnPHoC+gZON3Qz7njSwTlF/UwkWcNT0ceQuAaJlqAiNLinAQrMBa7k9K2BqKMWOOFev3mL
Xjk3j+ssjaxMz0BNdPf3QVcBdu2dbYBdf29fa1tHVlHJg7DwQ86uVjt3a6/fpW1/3vzgg60XQvZ7
xR6+8gKMQ5R69n762btpZ+6kH7uetNMtxO7MTevjl9aduOTg6Olw0nXLiQt7z7o6evh43r5HjHuW
9iyrKKu0GoegtpUY1yv+bgAYh/0DKDAvxAbRFiH/bntp+8WO4l2EGvY5wZdFOtWUReQoknwWiSvh
8CTVpLpwWeQEn9cEidcEq0e7VYV9tIdFEtCjBN4hl/hjocfgYwLOTH1/uxO5JJpkHDsMOBgzjgki
fVXWsCM1Go1fAWdKVAFh2A0ScOxwPdt3Ra6R9bQQ5WLxE/xzKMKHwz+t6igYx4GY0hCvAWdkKNKg
PtCArs6mggAmgsQEG7AicfPdJMyIIudclAziZSLHb3ENF3lGmKyU+d8dmbMjF44i/5acJCu5yD47
0meDj53LLZHDgDlwTeycd5++vP/A91vAPqWyE9GrQtbNztEN1tL6hqyK6oLqb3dUWbsx6Rh8rOPE
PYcSMC7yZQYYdzuYGHfGzX3HkSNgHOk4c0tjOzsrB4cthw6xjrsX+PhJeHB4QuzzlMTwuPCguJiK
hiac2WAugII4jF7TGaA/qwuajE9O4BQGX5AUvUfZLdlH5+Gca6hLiQQfNexzH0MNHPQxLAodjH0k
nso+LsM8CRn9JHoFzrg31F70QUpUOz+P/jY0Mtja2VXf2lrR2FDX0gLMdXZ2dnR0VFZX+UVGH/K4
ZXPi6vqT9xzOB+90jT5wKe7IleeO116evPbi4OWYLS6B5oev6m8+r2F9YOXaHRpWOwzt91puP7jj
6JlTrp6X795/EBod+iIjIbMwo7gSe57vq9LzccP0qCp0Dfo8VgNJrCclrDYStgIbzr7YekWSewyJ
gYVK+HzGwOEiT2LAweFJyHkq+7KSa2jp70EBoiH7cORU1GNN4CCnPSwSHC4S6kSCL4tyPyMHypl3
vLEUxgm6MctUc/ALDiaxj5wdNunjeIpDSozjHAa4wJg70ghMSnhJB+uODVX0LHE3Uk4VO4ByrmGH
cyyNh/6ZdAw7xU8IkyvADuwHzMl9GLns6swI2bfZuAG3Z59zOZeshKliRfqq6JH1nMvlywZclJP+
vpDvmkkHDWBygZzLSX//IdTIhbPJbcQk0Z6SwhcDdsQ4aDcBOGYcG0Wp716hX4N0s7OjfQO90Gip
RVX5Vd8+J1esfLuLA9gS+kwTPUyXVlwNxsWlC8bFPL8XFORx6/Ypj0s7jxyz3LjZwNxitRX9aS6r
rTu2HTlywtnJ7arP7adP/CLCo17ERUaGB8REVdTV4AzGmYBzemxqkj8QNDQ8DsT19g3xZ3AQJAJ2
OH9x/oNRymspnSNIOGfoIWGYoidTj+IzDZ1LmCKhATvoSHS2ioQi57QsFbmBJNDBj9G+g8ig6/8r
AI6HwKh7vJ6hDwH0D4+0dndXNTcBdo2tLW1d9L3VhpbWl9kFT6KSfJ/Gn70WecAzbItToN05/02n
HtsevWmy10vL3lHdbM9S/Q3L9KxXGlrpWmw03riLGOfpffnB44dhMSHPUnHxSCms5Puq9MHEvn4w
jv6kCaK26Wnu/FhDrA9WmzcECZtPO0dJds6RJHeQ4HPCeYOkKCjhRSeT0lGtFD2W9jD1W2UzLmL/
f8LZ9wF7/bXigR8lF8h/j1ALhwcrhRVSKE1eW9rpyusQpnKlSLznFYmPBRLjbx5oEwa1RzJb+N+c
eSId847pJjg4jQaYlXOmG0xKJ1ZSjB7OcY6wYUOwrWygFfcyRVHJGeRoxvWqU5Er98M3Qw0bF7kN
foi6ofhpBeP+2qUVRVkpfUCBEcM+jGeR7OAcRUkNnuX3379yexg3Y0c1/64eJrdN1rBxY9WizOXq
YS5eDV4mrw8caShyM9Uf5Vm4yJNkM1QqapQhPIerRDoR6XPQij1Lmu7d/PTUWGtXb3pZ7YuCilzx
XTlgDsj7FrfWkbJDDRiXU14LFFKsKu6r+kU/exAScunuvdOeXruOHrfevMXQ0srQ2pr+xOq27VB2
R53PuF69cifgSWhUcGhYoF9kKACHizM6Bk6v8cmxoRHxMubo2MjI2PDwKHjXP0CY6+7pQ/emHk53
FScRpeFExyUP5wJODfQNujC+p+6lSOJCSQbxT0ZJdhjRpxR9jCehiJlkEQk+EncqFDEXOqPoWqyb
3mIF0FVm38yhf9CoHRTGzDzWHcqupqmpoqm5vqW9o5Oe4+/s6imra0zIKr0TnuJ4NdL82NUVG8/+
vGbXjzp2v2iuXaRpvEhrzTI9E21jW7MNu7YdPX3a0/vqvcd3AsP9Yp9HpmQnF1TkV9VVNbW2dNI3
bLFD+AGMSfE6F3d4WiGxdXLTsDnsE2pEEoRiJFGCj0mcoyj97xwkbi9raOd+hPT7jP9hyjb4h+l0
oUERv4tJAmqYFYv7jVaEKIiDgnUTDcQykWNtuUirKxL7XM87Hzk2kHPeWN5q5eEA+BDkkok6euYD
UJMGxqGGeSepJ0UcjM4TFdKxwycPAw4mtpDONFJkKnSDsc89Tk5icnENz65apN0hKnnhKLLh53jS
D7xEuVBZZJOdX9YwAthkkeeSk1Qd1GMqF2G8EDbZ4O/10ucl8w0EuVhVQz1ybsZFuUwYz/L3NrIB
FzFJTlWtlA5PQi6L/DIG6zhmHAx0e/fx1Udcfl/Njo+Pon8m5BU8yyvNLKsBzljE8eNy8nV91ENc
KBlXBh3H91Xv+Ad63bl7ysNz97ET6xy2Glmvg44zXb8BjNty+MAxl/Pe9+88CX7y1O9eYHhweUPt
u1evccbgTJqamhgeHhwdGYJCQQfm+2j09cdh+hIeOnZ3/1BHT39TF32VHw54NzxCw1K4QgPRuO6J
E4XOEdHBRadFRtdG6ieqnUQW0TfgoAG3QY5K9rkZehcgIgBHUu411JyIW9FKBLNYgmIEHf9D5KEe
zWdm5sYmxtt7e2vbWqtbGhta6dvR9FGhzp6m5vbUvOIbwVHbHd21zB3+Y6nu//bT0v/9H4v+sUxL
y8zWwmHP9iOnT7p7X7p176Z/0IOouPCXmUl5ZbkVdZUNbY1tXfzdEXlrFVKOwjcVzPGaYxOwB2ir
lCiBw0CRiYvgkayHI5OskQ4nnDeEOKT3H9DzsHvh4OT69Pmr6JjIiGiYTicuZn//BbUCE0joqVRP
cFQmXkmxRKpkB4mnyoRDwbhBY2yjqKEtZfwhx+YjR0IlfIYdDDoX+0eqPMk4kuTKcJVqlPoOxpcs
GBwinTi1xE9j95LIwlaw0GMYMX+koRI16GvI2VDDlaq+bIAiFiLreQmo+cY4NtmTuaurGtergoZr
YFiiaiVyVdDAQZFrpMk27DPF2Fd1uBmM1xNFadwMxlO5pdwc+N+15AZclD4bN8C8cnY5iadyzr/C
bRRRqvKZEh6Pg334TOEqrnhdA32ZFaXR6ekJWblAGL3wIOLTwnoRpYr3H7imoFrqOLqvKt5XfXY/
iHQcM85myzbjdbarLa1NbO2stm/fcuSIo7v7jfs3Hjy66xceAsDh5PsNB/Pdm4nZSei2iTGiG+QJ
MAfGKdM4MEcB7PD44NBY98Bwe08/FA3/BbnWzh6wb2iMbjJiaXz2oxsgx5mCInUJ8XI+iT7lQ3Pk
KfsJEnUyFcZxPddwL0IOHxd6WtS7D1xDk95+ZNJxLnqTuAPw6jWN6wF6s6+w/gATj9mVNdY2tbX2
9HUPDNA9ioyC4rsBYfvOOGtbr//vyzUXqumb2m4B4067eXnfunPDL/BxRFxEchZkMhhX3kB/UBWL
Au6B/jHlqw6zyidIkOQKiw2ipLo3kLPDvsw5qfpyFk7wOSl9Vh/onzifvnz8/AlijTr8Z1RB2b1H
DSe0h+pBS5qK0OEzJn8FGYW4w+yKRAWRuMi/gpwpiZWROX5a9H/aKK4U8ymOFxI2n3eCTHxEBPXo
VgYdIZFQg6KsQcCryjhxaSPqsU8H/x0OuhgkUdw0mBfPlhL+sAXMJna+M6wmTDrsc5Ed9nl2dni7
f5A9GYZuD+MuLR1ZDwc17GApPBW5antpsvjd7FxEzg5WgitlMCtbytlVjRf1XRteCIwncREOc5Nn
VG0AB23k0uDwLMjlotjkZn43iXwxMKeMVUG318jp8RF6g/UVek5lc0tsRm5QfPKztNy8Sno5nyJT
EE35hyCg4xCowpE6LimvPCadYtXA+OcPQ8LAuLOXvPedPGW7dbvROts11jbQceYO27adPO51/fL9
ezeDIsJKa+txXcUxBR9wpaWH18fGxsVzAgAcfAXfELaOjkO2AHMs6AYHhyHgegaGu/oGWzp7Gzq6
6zvJGju7O/sGB0fHoKFwruKE5LOfT31OKNKuUUGYTNwADnoFHOQ8L09FEtMJH8AZOhq3gawD8li7
CU3HRt0JNWSiBvrj1fy7kYnJroGB2tb2orq6oprq2sYGhLHQqiNjo20d7c+SEk95e1vuPmC1Y/9x
Vw+ve/duBQQ/jaJY9WV+ORgH7dzQ2smMwzzYSxyrqt5dxSrRCv1tqznxJEGKvyTUcILP7RVllZbS
B2GUbQTS3sPhrvv582///vzHf37943+iMc68P/78N/mffhPY+gyuYd8DTShSd6a+LSCovIErlvkt
oYh6JDj4Ra7kA4FNIdaIxAtBG07K7VVwE0WeBXuG9w9dCpQJ+41VHhKK0uHE7ZGLEsFOhLcQgJCB
0xzqisE7ulEgSYddwTlq2JeOqnED1Rr0TdUiGvzAPZY7PPdnzrljs8MsYMNU5hF85CjKSbIxKuVC
uIFqDbeURf4VbiYNRVkPRzZWNVTKejkLHDmJK+UCYdxYziJbqk5iHzmWxruJV4ANPhtN+haoqjDu
Nd2Sb+vuSykqfRwV/yg8/ll6QU5VbWmD4j4DDHQD174pOxmrMuNepgclvHgQHHrl3gMn78sHTp2x
274TdAPjQDqbnXsuervcu389ICykuLJydmYK/QPn3szcLLo5FNz0pOILjkis44h645NjY4hbCXMQ
L7D+AfryHRjXNzjW0z8C0qHbN3d013Z21rS117Z3Nnb2dPQOIIxF/8e5icsvLrwIh5GjayjOezGK
h7MfiWuQy8Rdgqci8VTUwUc9utv8qzeTU3Ozc69wNRcXdYgFwbg3CJrI4Ive8hZoE+NFooO9fvf+
FU0an5jp6B2sbm4rrq1LLyvOKimub2iZn5z8/dP79u4e78f++y64u92kZ0f8E5KxY5MLKsA4XGnq
2jr58RGOVZlxyliMfoY7JK+zWHfFynOCL4mgygX2lZtJSU7lIhxmEBKWyQRBJxSGMwqn19evf/7n
m8mB8e7qwdbS3rqkgcasgfaK0e5GIODrlz9FcPqJtZeAmuIUFcuB/5eESuSo50nU0/6WeEZMEnNQ
kpWqPnJOWG1x7Cipko6EnCCdzAXoviWuEY0UL+2zTYv3/0XAS9T7QI+yicdNBNH+bpJo8Nn51h9V
AIeuipxn+cY42b1VDThTZQEcLrLzXY2sZ0fOghw/wT4bzwuTC+FK5KriS9ZzY14IT5W/wj4bT2VH
tc13GyjrZQ07qsa/xfcWADJZySYnkY4TdMMpiBAV16WJ8aHO/v7sypo7QaEet24/jIh+nl2YW1HD
RJPjceAa+2BcflVddlkNMS6/LCazAIwLiH2BWNX3/kMwbv/JU/Y79prZbdIT3zo/6+Hy+NHdsOiQ
ouoqnCH08Pa797Oz06AbWDY1I557En+ZASHYlPhKjhB0SsAJE0HrGDAHxsEAOzCO887eAQC6qau3
rqOrqqWturW9nh5do0G7qelZdH4+v5FE3/8vFI1i8l95h5aKWsE4zDc2NdvU3t3U3gtU4QKOKvQZ
JExiwKErMeaQQ8fRY3Ui8dC2GNGm4W2gcXp2BltUXlOfkJWdUVLSN9z7//1f//5f/+v/nV5U5nL7
4Z3gqIikzLjMAjAOgppiVfHX9sTnlRSvc0nGIdFPKINorC6vObZRrLxio2RRJlSqQoEbiLaKIhLX
IIcPUvEk5LhUfv79XxAOEOKd9SmFsU5Zgfuyg4/lBh8pjDybG3k+zX9/Q1Hg57dvf/v93zj9KLCl
3otEEZWoUbAMCT4SEw25mIofYiYSy7iNbEnziMRFTtwS64Yck9hBzol3DvYSEh8UJPaxA1UrkYA1
lsnI+VFknKhIYphY8ZnS6amJuVn6IiS/akWDdCqSDT4jTxZVfXa+81W2+sMPssNzN0ZRtea/xIEs
/pcNOEc9T+Vm3zWQlcxQ+JxzM/gw9rklVpSLsoYb8FxssgGbXAKMp/JcnH83lRtgv8iWtJsEwsQz
g+J5EUabyDFViDgEqqTg6PUGHMdpiKbhtu7+rMo6X//gY87O7tevP4599jy3KK/8L4zju6vS5H3V
pIJyybgHQSHQcRcu+YBxttt2GVrZGlhYHT53LvDpnbD4mKKKiumpsS+fqXcBrOOjFHMBbbPg28w0
mTIpGYc0MTo2MQLSiYE5vgvRNzTaOzgCY9IhSoWBdO1d/dgQWGNHX01rV0Vze0VjR11rd3vPAObC
+YpTHMpOsIswx4nW5q/Ch4vchZBosoh9Aa7W3oGyxvb2gdHpefFQlWjJnQdJ+q8R/avIutev3rOa
m39LECTdh7nfIfSjrgjYNbS0Z5eWd/R0/3/+5+//v//Xf2aXVd0OiQl7QR/ITCmszK9qAOMQmEO0
Doo301UZx1oD3RLL51/nJDfnu4RfVHgiyaKqQ5sskoQFliYmUqiOs+nz1y+//fH727kpSLaSZ57p
AQeyA/ZlBO1LCz2cHXExJ+JCbviprID9ucGHWkqjsJAvf/wbOf4Xg3df8QuiP39jlkzKGkX/Fx3+
G+aQPn/+SuJR2ZInyYRKrCUc6jPKIjaEDw32Eu8rTrzHmG6ScVK7YfdOTE3Si2MjY9jtuLrgHOMP
DnZ19QwMDIyPjUxNjr6aneDPlwFzYm1pL/GaS8PGolJulKoj9sM3usmWpOO4q6MKuSo1eBI7HJ/K
esaENJ6k2kCa6iTkbPK35OzsyFlgqg6MZ+Gi6lyqRV5JrueWbFypXILiFi2M9wi3+f0zPe3MbVD8
dlf709tPX999EK80gCkyPv3y4S2h7d0cEDM/PTU6TB/ILG5sjEpJvXj1xqb9B3Yed7z84HFg/PMX
OUXUteroFipIR1ATHwdWAE6MzYFx9J4DdFx6HkRHUOyLRyGhV+7ed/L23X/ijPWmbXpWNkfOnPYP
ehgRF1VQWTE5PYW1RUKgBwXH0RaPnTPaOCmlnMKAOaBODswNDA4PDCIn0vVIzPUOAHOIUhEGdnQP
MOwg6+o7uyub2gEI5PVtPe09UIGjYApOZWWnVYg15bgyiSBRSw+jCB9T6UvCOAMBLFqlyWkAC3Mh
EUuUgS13GCwZDtMNvwCDg6WyvpMOgU8M3qEp/2Jb30BJZU1Ld8uX96///ftvyUWl/gkpcTkFGcWV
hRUNFY1tCMPRx4YGaVcw40BtME5KOV4B1YQ1wMJ5+bQ2ysR0gMOTOKGDoRXy94hG33/Bar77AGFC
I2LIyflE91URe375+vurVxP9rZXlSb6ZIQfTHu/KDD4OHZcTcjwj/HjxM5fc0FMZoccyAvenP9kF
NVeXH4S9B8xh4QgkcPLCwa8hp9MVOU6LT7+Js5eoxNiS8JK0QnvMzDmf5x8/vOPzH4aV56kwzILV
5m3nXYGdg11EDFMZeqNdhH32+g0/C4QaehPilfhU8swszkGce7is9gwMdnb1NTR34EQqqG5MLiqH
IECs0NPTMzEyPDs59mZ+ir5ri72HCEmsAH4WxivJe5VNsdpKusHhbeEa2QCzEONgEgqMA1VftQGW
olpkX7UGJiehMbfneulIU12ILHINO1zJJhclm8kGf/8V5DC5tnDkVDb2uQHnOPFwVYOvMBGikkzD
zhL3T79+Ae/o6V8KTulDcqTd5qYRIg61d/eUNjTFZmS73Lm7/dAR6207bXfu2nfqgs+9J0HxSfxp
RjCOHv0Vj4yAaxJz7OdW0HeAX+SVgnGRLzNCE17eDw/3vnfvjJfX7pOnLRy2HTvtGBzkFxEXk1tc
CJlPZ+qnL6/m5iHTcIVknDHmmHdIcJAwaXJyepxuQ0zxqBwAh77NQSsuqhS0Do+Bcb0gnbgFwYwj
Qdc7RJjrGWjp6UdNa1cf6FDbBth1ltW3lTe017TSmN3g6BhOZYSNdNOVMIau/JlYBS58pE8KwxCf
kSb48FnemUWiE5MeFebbbQq0cS+iPiPAB54wy/5uomcpJsHjrsU07B4cTMxMiUsIHenvrm5ujU7L
jc0qzCypKqlurGlpZ8bxt85p/4m9h01g3YGEFRArqEjUv4V+YYf6jfDhIPFWMMqRcyW2l0JSUpef
CT2i04mWNMYPcHz+7d9vXs+OtOXUpD8pir2WFXE2L+J0QYRLcZxnUbxnfpx7ZqhjTuhRCLrsoP2Z
/gcy/A5mBB5E9NpYEAEt/NvvfwJn9KbNRzq3Bc0YZEQ90I6LKlBTdEZ2YKogYOO+wD4cniq2RUE3
opqSa9hXvLtkJYrsi0eG6QzEXhVDKBQ94ILa0zuIPV/d0llU25xcUh2elnsrLPZ2WGxSflFja1t/
X8/U+NCb2Un6+hH20ie6/0DbonykDsZFsQ+/rTlP5UmqNdKnZ0dgDA6mCeOAizL/u4M9wkV2eByN
fenA0JiNa9jnNtxA+lzP9l0zLspZ2FGdi6fKGulzM2myBpssK7Ej6NB+Qf0XXAAVCk6h18TniD++
4Td531OMNfdG/GXCmcmRgaH+pu6uvJqayNTUKw8fbT94yNDc0sDMwmbrTod9h46cc/F9GBickJKY
V55f2VRaI15vEI+McMTKsCuqpT9dmFtRk1JYDhqCcWFJafSeQ0j4tQcPz3l5bT1+/LSrW2DQk5j4
iKyiEgBKHOBP6InonNQ/ZxUvYPNZhRp0V+TovYw5JBJNwoA5Zhx0HAdrrOZIygFw4k4rpBxkmiJo
7e6DjuvsG0IO2DV39zZ19UDT1bX3IIYF7IrqW4vrWiDuQECwElJIjJG9ItTR2SggIRL3Fs6p/s1b
xRlLz+wTNdCLOOdOJWaiIiMPlVzkJCpJyilNESi9nn+FZc6+fhWbnr5j35Yzp/ZHRwSnFVcnFZTT
+6q19B1g+nsO/fRxpdHRUWYcdh3WnHspL0f1t+BjtZHYofUXKyMrUXzz8S3pKIFygRRslHij6CO1
B1gU3fLzH799/fer+am+hrSSRLf8iBP54c7ZwSdzAo+XxzvlRrs9uGCT6HeoNNEnL/xCdsjpzAin
vKgLoF5R9IXs0ONZwQdf3NlYmXqPTto//o0TGZcTLByrwdpNMI44pUSeOLcFAmDsc86mWCtRCR9b
ozRabWwa4IU9QPtVmYTepX311/QauxCXCT4DkSCQsXuHhkZ6B4e6+odaOnurmjvyapteltZEZBQ+
eJbi+iBg88lzGw+euB0UmldW0dnZPjk6ND81Rh95e09fb8Nq8GpLR66hqsPG28IO6lVzhY6DYSMl
AtiR+OAiG6Z+BxTVSbKGc27MU7nIjvwt2UzVl81kEYapqvU8SVbCgXGsioXDeGnsc2NuyTV8UJFz
PXzkKHINVAh2McekMBrXF38OAnSbm6IPmg8M9da3d2aVlgc9f+5x+8beYwet7awMjfSNTIyNLNdZ
O+zccfDEUSfPKw8CwhMzkvIrIMvLamk8jgEnA1XhKxgHHfcspxiKgxn3KDT86t0Hju4eFy9f9gv2
D40JTS/IHRob/fLhPXiMfjg3NQkFNzNLgx1MNyTp4CRjuvEJJ1xSc/IGKw3JiXuskDPo74ohuYER
AI6lHDMOBqUG5IFxoBgA1yieL2HDTqht78S5W1LXXlDbWlRDH8Vrau/uHx2dnUUcSn8fRzwDRXcG
hMBT9ByZI4lKkkKcmCnYQORIAjJUg0lc5Fw24HoUkdAhkeOH0OBuRMxKLY1fF/7j6LEdOQXFOZWN
2MlldYrvjvT20R83oEFKcXMGnRbzIjHjOMHHwqmXiF+Bg4SzRPCLaogKynpZgwZcCbqRthM+ut7H
D19/+x3abX6oraAiyScr+HB24KHs8NN5URfhv7zvEOFr77JDzWmbOlTbTcfVgZe2VyVfKYlzyg05
U5LgUZ5wHs1S/fbkhp5IebyjsTDk08fffv/jX/SLBK+vuEjjF8E4OrFxAqvEoWzc/+V5jqncgB0k
sR2UsM68B7A7GWe4auLU4hy7C47EHBxUyvMNCWgbHh0ZGhnuoz9G3lvT1lHa3JZZ1fiiqDIsq+RJ
Ypa3f/gBF0+TDZsWrFxlaGlx8+njrOKCjo42dKxX0xPQcW/pE5avGVJYbTjI2djnenbkhmASz4KT
iJtxrtBxsvNjF8CHMSNUHRjjADXcTHUSfLa/T0INT5I1XMm/y/Wc8wp8twTVInJ25Oyq+pHrVX25
QDYUeS74yLE7vshvefItVGH87RAY3eV5Pfdxfvb1zCT9VZph6Jqusob6Z7k5d0NDLl722nd0n/1G
m7Um+gb62vqrDfSMjPTNrKy37t1+0NHR7fIN/7CwF+lgHFiGzk9vNTSQlAPd+LE4+MjFeFw1dBxi
1bjMgtDEVDAOy790997lBw+DwsJDo8KScjLAI8Lupw9vX7+bmQLFJuhUm8EJ+O2LOnzC8VnIZ55M
OPmYcYw5vvnAjGMpRzcfhsb4gRJceIE2AI5vtsJH0ArGwXBBbu7oaerqRdzR0NUDojW099a1dle1
dpc0tudUN6WX1qWV1+fXNgB//cMjWA0wTjwNQE9AIUF2vaHw9SMZYleRROeiBB+8QIKvSjd0OeSo
4YRKdrg3sgMqQWl/fv9hfHZ21+nz/4//87/986cfTU21wyMCShvaCqvqyxubG9vopmpPbz+2HbsC
CWuIJDGHxEtD/t2KIZfrA59oIRJqcGRoIkJzZgWF6fQcP/77/OWPr7/9G9fIwbaSssTrOSGOOWGO
aUHHc6MvZIY7ZoccSfLbf+Ok2ZmNK6+fMIm4ufHBWeNzm1Y8e7gv/sH2ey6WWeGOuUEnc8NPQcdl
Bx/LDj2ZFXwyI+BwQ27A9EjXl69//vbbHxQOwz5/xS9D0FF8TENpdMJjHeGzw7msQc6V5IlEO1Qk
Jbzm5PUSOXxOvLtEAwIfaqDaJsfFn7IfHYN2g0zGRRFKv6i+HSdDTE7p05Ts2zEvXB/5H3X13rh7
v6GZ2aqVSxf+8o+1NmsfhwUUlBV1dLaMDvbNT40z4+hxOSWnYKprrmrchuu5JdfIepjiPQd0eOlI
BMAkUKTDk9iRxlNVG2BpvEAu/pcmJ6GlrGTDAiW8YPBRw+3lb7HJhbBhKkz119lQxNbKSvjIJd34
Q5gfP9HHQZlr/Hej5+cm6c/jjwx19HRXNDWmlZSEvnhx+d69oxfObd6+0drW3MrS1NLM2NTESM9A
X01LV0PbQG/tOpvtB3YdOXPS9dIN/5CI5KzkgoqiarqdJ8fjeBhOqjkwLqu8NrmIGBefVRj+MjMg
9sWdsLB7YWGR8fHh0TEJKWl9Q4NQcNgInH/iqaJpKLhXc/SFIpyO5PztSgsHic9OPk0RlrGIE2Pt
k8Q4HpIbHEbePzDCEasQdMPfbrb2DsBYzSFopVG5jr7mroGmnr7m3v7mrqGG9v76th5grrqls6q1
s7QJIUlLWkVTcml9UlFVTnVDbUdP/8g4usTHt/QUHM5ASC0RxgoqKCNNxgeS5AhXIskG1P9UfDjs
oz2KAk/vcbJkVVUt1tRd+uM/NVauUFux0Peae0lNXVkDXWkaWjs7EVYP0Ptt2A/YM9hXnBhwLOWw
NF4scnZkkvXIBc8osXYQ09H3SOjRw4MfP//2+5+QsKM91dUZd/IiXXIjz2eGHc8NP5kdfCI38mx6
0P6c0KM5oaceXdri5+MQcmX7qfUrEK5mhJ4Iu2x3bL169INzz/0OnNiwIuzqzryoc1khJ3ICD+RG
HM+OPJrht7/s+bWJoRb8BKD2G43BgXHvcI7j/Mapjk4u+z/3CK7kGpFTEiuPw0I7FpuP04lPGx7r
4MsAJz6vJNq4Gf2NLeWfFkP4jx0LutGgW317SllDVE7506Tsq6HPzl+/scvR0XLzRhMzUx1tdXW1
5dpqy5cv+mXdZju/yND8itLOjpbJkYHZiZHXs1Nv3s6JEEpBMRjWlo2LqGeTU9nnBjxJtlfcV+Vu
z5hgCjAOVGvYGDE8FcYNmCzckotydtmG22OSrJeTvjM5iR32eUbV3+UamHRUZ+GWyGFcjw2kmk/v
vn75oLiBoPwmErj2jv4ADd0kJYLQbaCR3v6etu720kZCW1hi4nW/x+cvee46etB243oLc5O1ZjhY
xuZrTU1MjNasWa2tq6OuraOpS4xbv/PQvhMXTrn73AwIjkrOTC2qQpSK3oUcaAPjYJJxhTVNeZX1
mWU1KcUVifllCdlFzLighBcxL5PDo6NepKb2DAzSXdRP1OvmZmYnp+nDIfPzik/CIoke+i3hXGSo
cS6LrOAk40bHJjhipc+TiHe8cIICbfRAyZDisRJGHgWtQtkBc+09dBdCPENHcSsEHeu42pau2rbe
mtaeypauiubOisaO4tq27Mqm5JK65/mViYWV2RV1FW2dfSMjk7MzCF/pXATi6JMY9IAxEnoa9TMB
FyR2qPsJ0cQO18hmNJtSxHGOIzzz+t2u06cX/o///aTVGkPtVYuXLdixfXN4TFhVUwuUhWBcTx9k
HL3RS7sIfZV3I7o3Aw45Fi5+RLEO1FdEDXzihEi8VowJTGfpILz3CBAQSMIf6aiqzbqTG3YsN9Qx
O/J0fuzFsjivnJCTkG95kGPBh/JinAqjz4X4bnrovMnfw+aJm2XS4703Thidtdd84r7x+YNdZ+yX
eB83ywwGCo/mBBzKCj6YGbovL+J0esjRnJDjxVEX+5pzf/vXv+ntiM/0ghfdWRWM407Oxp0CDtcL
uFHC+mOjaJNxoaQ/rjYzPjHFzxjhxMB5gusicUwJOKYbn1GcGHBojLOlvbuvuq2rsK4lpbQmJqfY
Lyn9akjU6cs3th87ZWFjvtpQR1NjhbbaUq1VS7Q0V+pra6xattR+56ag2MiiijJm3NzkGLTFu7ek
43B6YF+KtVXgjB0YbQi2S+lzJU4H+DBuyQ7sL++rMguQq8ICBEGRYcFT2ed62RKOrIED49Ex1Um8
NNlMGlfycrg9GxflGqKGf5preEY4cl7ZQBYxiXe
Votre Commentaire / Vos ExplicationsMail reçu soit disant La Banque Postale dont je ne suis pas client.
Demande de se connecter par un bouton dont le lien est :
http://ncr05thc.r.us-east-1.awstrack.me/L0/http:%2F%2F202.46.156.8%2F/4/0100016c50046cf8-3b396c8f-a527-4722-89c5-bf93963d86aa-000000/SL1dNnVfFQM2vLnkoPlZANMD8MY=121
Pour en Savoir +Comment signaler une arnaque de Phishing ?
Numéro de téléphone dangereux détecté dans ce signalement d'arnaque: Lisez cet article.
Article: Qu'est-ce que le Phishing ?
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !

1 commentaire


Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Italien Allemand Espagnol