Arnaque identité (Phishing) : ameli@assurance.cpam.com Ameli@Assurance | CPAM .com

ARNAQUE SUSPECTÉE !!!

Date10/08/2019
Email frauduleuxameli@assurance.cpam.com
Pseudonyme utiliséAmeli@Assurance | CPAM .com
Url / Site internethttps://mon-assure-gestions.com/formulaire
Contenu de l'arnaqueDe : Ameli@Assurance.CPAM.com [mailto:Ameli@Assurance.CPAM.com]
ameli@assurance.cpam.com
4f87b9206daa3cf46fe24ceb999be883@mwinf5c27.me-wanadoo.net
Envoyé : mercredi 7 août 2019 15:31
À : prenom.nom
Objet : *** SPAM *** Ameli Assurance - CONSULTER VOTRE DERNIER REMBOURSEMENT

Pièces jointes un fichier au format PDF Ameli_Remboursement.pdf (193 Ko)

Logo usurpé de l’Assurance Maladie Mon Compte mon parcours d’assuré sans autorisation officielle de la CPAM et à leur insu

Cher(e) assuré(e),

Une information importante vous attend dans la rubrique notifications de votre compte Ameli :

Vous trouverez les démarches à suivre en téléchargeant le message en pièce jointe (Ci- Joint) .

Grâce à votre compte, vous pouvez à tout moment et en toute sécurité :

• échanger avec votre caisse,
• commander une Carte Européenne d'Assurance Maladie (CEAM),
• télécharger votre attestation de droits ou d'indemnités journalières,
• suivre en temps réel vos remboursements.

Merci de votre confiance

Votre caisse d'Assurance Maladie

Voici le contenu de ce fichier au format PDF (r)attaché en pièces jointes : Ameli_Remboursement.pdf (193 Ko)

« ameli.fr
L’ASSURANCE MALADIE EN LIGNE

Formulaire de Remboursement

Bonjour

Votre remboursement vient d’être mise en paiement.

Pour nous permettre de vous verser rapidement cette somme,merci de mettre à jour vos données.

Suivez le versement de votre remboursement en cliquant sur mon compte ameli.

Nous vous demandons de mettre a jour vos données pour que votre remboursement soit effectué dans les plus brefs delais

Cadenas MON COMPTE AMELI [Ne pas cliquer ce lien URL frauduleux sécurisé https://mon-assure-gestions.com/formulaire qui vous redirige vers un faux site : https://www.assureo-clients.eu/service/ameli sécurisé imitant la page web d’un formulaire en ligne de la caisse primaire d’assurance maladie (CPAM | Ameli.fr) à leur insu pour usurper vos (coor)données confidentielles (identifiant, les mots de passe, code d’accès, etc) en se faisant pour vous « à votre place » auprès de la sécu pour accéder directement à votre espace perso sans que vous le sachiez]

Nous vous remercions et nous vous prions d’agréer, madame, monsieur, nos salutations distinguées

Votre caisse d’assurance maladie Ameli.Rendez-vous sur ameli.fr l’Assurance Maladie en ligne

NB : Ce message vous est adressé automatiquement. Merci de ne pas y répondre.

Ce message et toutes les pièces jointes sont confidentiels et établis à l’intention exclusive de son ou ses destinataires. Si vous avez reçu ce message par erreur, merci d’en avertir immédiatement l’émetteur et de détruire le message. Toute modification, édition, utilisation ou diffusion non autorisée est interdite. L’émetteur décline toute responsabilité au titre de ce message s’il a été modifié, déformé, falsifié, infecté par un virus ou encore édité ou diffusé sans autorisation.

This message and any attachments are confidential and intended for the named addressee(s)
Only. If you have received this message in error, please notify immediately the sender, then delete the message.
Any unauthorized modification, edition, use or dissemination is prohibited. The sender does not be liable for this message if it has been modified, altered, falsified, infected by a virus or even e”

---------------------------------------------------

En-têtes Internet / source du message :

Return-Path: ameli@assurance.cpam.com
Received: from mwinf5c27 (mwinf5c27 [10.223.111.77])

Whois IP 10.223.111.77

OrgAbuseHandle: IANA-IP-ARIN
OrgAbuseName: ICANN
OrgAbusePhone: +1-310-301-5820
OrgAbuseEmail: abuse@iana.org
OrgAbuseRef: https://rdap.arin.net/registry/entity/IANA-IP-ARIN

by mwinb2z06 with LMTPA;
Wed, 07 Aug 2019 15:39:53 +0200
X-Sieve: CMU Sieve 2.3
Received: from sd-win-1.y2khosting.biz ([81.29.205.231])

Whois IP 81.29.205.231

Information related to 81.29.205.224 - 81.29.205.255

Abuse contact for 81.29.205.224 - 81.29.205.255 is noc@eu.equinix.com

inetnum: 81.29.205.224 - 81.29.205.255
netname: TCEXMACHINA

TELECITYGROUP spécialisée dans le secteur d'activité du traitement de données, hébergement et activités connexes.

TelecityGroup (antérieurement TelecityRedbus) était une entreprise britannique gérant des centres de données en Europe, née à la suite de la fusion entre Telecity et Redbus Interhouse, avant d'être finalement rachetée par Equinixen 2016.

TelecityGroup permet d'héberger des serveurs et équipements soit dans des baies mutualisées ou non, soit dans une suite privative (zone grillagée ou séparée comportant de nombreuses baies), et accueille plusieurs points d'échange Internet (IXP) permettant aux opérateurs de faire du peering.

TelecityGroup, dont le siège est situé à Londres, gère 22 centres de données localisés dans certains des principaux centres d’affaires européens. Coté à la Bourse de Londres, il a fait partie de l'indice FTSE 250 jusqu'à son rachat.

Equinix a des bureaux dans le monde entier. Localisez le bureau d'Equinix le plus proche de chez vous.

descr: TeleCity Group Customer - Ex Machina

Exmachina srl
via Savona 123
IT- 20144 Milano (MI), Italia [Italie
Tel: +39 02 3652 4687
Email; abuse@exmachina.it
Website : https://www.exmachina.it/

country: IT(ALIE)| IT(ALIA)

Equinix Italy
Via Savona 125,
IT-20144 Milano (MI)
Tel: +39.02.3667.9500
Email : it.sales@eu.equinix.com
In case of abuse please email; abuse@exmachina.it

admin-c: TA515-RIPE
tech-c: TT556-RIPE
status: ASSIGNED PA
mnt-by: TELECITY-MNT
created: 2011-11-02T13:58:35Z
last-modified: 2011-11-02T13:58:35Z
source: RIPE # Filtered

role: Equinix (formerly Telecity) Admin-c
Equinix United Kingdom
8 Buckingham Avenue,
Slough SL1 4AX, United Kingdom
Tel: +44.207.634.4131
Email: Receptionist.LD5@eu.equinix.com
address: UK
phone: +44 207 0056958
fax-no: +44 207 5318750

remarks:+-------------------------------------------------
All reports regarding these networks should be sent to abuse-mailbox:
If you report abuse to any other address you will get no response.
Tous les rapports concernant ces réseaux doivent être envoyés à la boîte aux lettres (BAL)
d’abus : Si vous signalez un abus à une autre adresse, vous ne recevrez aucune réponse.

remarks:+-------------------------------------------------
Trouble: In case of abuse email abuse-mailbox
abuse-mailbox: abuse@eu.equinix.com
Problème: En cas d'abus, signaler à la boîte aux lettres (BAL) d’abus : abuse@eu.equinix.com

À propos d’
Equinix connecte les plus grandes entreprises internationales à leurs clients, employés et
partenaires au sein des datacentres les plus interconnectés au monde, dans 52 marchés sur cinq continents. Les bureaux d'Equinix en France se trouvent à Saint-Denis et nos datacentres à Roissy, Pantin et Saint-Denis.

Equinix France
114 Rue Ambroise Croizat,
93200 Saint-Denis, France
Tél: +33.148.17.65.00
Email : france@eu.equinix.com
Site web : https://www.equinix.fr/

admin-c: IIA6-RIPE
tech-c: IIA6-RIPE
nic-hdl: TA515-RIPE
mnt-by: EQUINIX-MNT
created: 2002-09-03T17:08:18Z
last-modified: 2018-02-26T15:17:34Z
source: RIPE # Filtered

role: Equinix (formerly Telecity) Tech-c

TELECITYGROUP INTERNATIONAL LIMITED
11 Devonshire Square,
London, EC2M 4YR, UK
Tel:: +44.845.373.2999
Email: ServiceDesk.UK@eu.equinix.com
notify: ripe@eu.equinix.com

person:

Michael Van Rensburg
4th Floor, 2 Harbour Exchange Square,
London, E14 9GE
Tel: +44 207 005 6056
phone: +44 207 0056958
fax-no: +44 207 5318750
Email: michael.vanrensburg@eu.equinix.com

mnt-by: tcie-MNT
mnt-by: telecity-mnt
nic-hdl: MVR9-RIPE
created: 2002-08-27T13:05:33Z
last-modified: 2017-12-07T13:27:26Z
source: RIPE

address: UK
address:E14 9GE
remarks:+-------------------------------------------------
All reports regarding these networks should be sent to abuse-mailbox: If you report abuse to any other address you will get no response.
remarks:+-------------------------------------------------
Trouble: In case of abuse email abuse-mailbox:
abuse-mailbox: abuse@eu.equinix.com

admin-c: IIA6-RIPE
tech-c: IIA6-RIPE
nic-hdl: TT556-RIPE
remarks: Role to be used for tech-c function
mnt-by: EQUINIX-MNT
created: 2002-09-03T16:56:48Z
last-modified: 2018-02-26T15:18:30Z
source: RIPE # Filtered

Information related to 81.29.192.0/20AS15830

route: 81.29.192.0/20
descr: Route Originated By Telecity Milan
origin: AS15830
mnt-by: TELECITY-MNT
created: 2008-09-26T09:30:04Z
last-modified: 2008-09-26T09:30:04Z
source: RIPE

Information related to 81.29.192.0/20AS24938

route: 81.29.192.0/20
descr: TELECITY-IT-81.29.192.0-20
origin: AS24938
mnt-by: TELECITY-MNT
mnt-by: EQUINIX-MNT
created: 2004-03-13T08:13:45Z
last-modified: 2018-02-26T15:51:33Z
source: RIPE
by mwinf5c27 with ME
id mDfn2000J504Y1M01DfnHw; Wed, 07 Aug 2019 15:39:48 +0200
X-bcc: prenom.nom@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (305)(1000)gggruggvucftvghtrhhoucdtuddrgeduvddrudduvddgieejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrihhlohhuthemucegtddtnecuogfrhhhishhhihhnghdqhfhilhgvpfgrmhgvucdlfedttddmnegonfftqdeuohhunhguqdftfedvucdlhedmnecujfgurhephffuvfgtggffsehmtddtredttddunecuhfhrohhmpedftehmvghlihestehsshhurhgrnhgtvgdrvefrtefordgtohhmfdcuoeetmhgvlhhiseetshhsuhhrrghntggvrdevrfetofdrtghomheqnecukfhppeekuddrvdelrddvtdehrddvfedunecurfgrrhgrmhephhgvlhhopehsugdqfihinhdquddrhidvkhhhohhsthhinhhgrdgsihiipdhinhgvthepkedurddvledrvddthedrvdefuddpmhgrihhlfhhrohhmpegrmhgvlhhisegrshhsuhhrrghntggvrdgtphgrmhdrtghomhdprhgtphhtthhopehphhhilhhiphhpvgdrtghoqhhuvghtieekjeesohhrrghnghgvrdhfrhenucevlhhushhtvghrufhiiigvpedt
X-me-spamlevel: med
X-ME-Helo: sd-win-1.y2khosting.biz
X-ME-IP: 81.29.205.231
X-ME-Entity: ofr
Message-ID: 4f87b9206daa3cf46fe24ceb999be883@mwinf5c27.me-wanadoo.net
Received: from 185.81.157.64 ([127.0.0.1]) by y2khosting.biz with MailEnable ESMTP; Wed, 07 Aug 2019 15:29:41 +0200

Whois IP 185.81.157.64

Information related to 185.81.157.0 - 185.81.157.255

Abuse contact for 185.81.157.0 - 185.81.157.255 is abuse@free-h.org

inetnum: 185.81.157.0 - 185.81.157.255
netname: INU-VPS01
descr: Inulogic Virtual Private Servers

Inulogic, SARL
Hébergeur : SARL Inulogic
17 rue calmette, 69800 ST PRIEST
Tél: +33 (0) 4 82 53 25 74
Directeur de la publication : Gurvan Rottier-Ripoche
Email : gus@free-h.org
Site web: https://www.inulogic.fr/

Service Abuse
Contact : Gurvan Rottier-Ripoche
AbuseMailbox : abuse@free-h.org

country: FR(ANCE)
admin-c: GR8035-RIPE
tech-c: GR8035-RIPE
status: ASSIGNED PA
mnt-by: MNT-INU
mnt-lower: MNT-INU
mnt-routes: MNT-INU
created: 2014-12-24T00:45:27Z
last-modified: 2014-12-24T00:45:27Z
source: RIPE

person:

Gurvan Rottier-Ripoche
17 RUE CALMETTE
69800 SAINT-PRIEST, FRANCE
Tél: +33 (0) 4 82 53 25 74

nic-hdl: GR8035-RIPE
mnt-by: MNT-INU
created: 2013-07-24T18:22:21Z
last-modified: 2017-10-30T22:28:14Z
source: RIPE # Filtered

Information related to 185.81.156.0/22AS198375

route: 185.81.156.0/22
descr: Inulogic Route
origin: AS198375
mnt-by: MNT-INU
created:2015-02-27T18:31:34Z
last-modified: 2015-02-27T18:31:34Z
source: RIPE

Whois IP 127.0.0.1

OrgAbuseHandle: IANA-IP-ARIN
OrgAbuseName: ICANN
OrgAbusePhone: +1-310-301-5820
OrgAbuseEmail: abuse@iana.org
OrgAbuseRef: https://rdap.arin.net/registry/entity/IANA-IP-ARIN

y2khosting.biz | http://www.y2khosting.it/

Explora S.r.l.
Via Trento Trieste 5/1
IT- 17025 Loano (SV), Italia | Italie
Tel : +39 800 978 434 du Lun au ven : de 8 hrs à 12 hrs et de 14 hrs à 18 hrs
Fax: +39 019 20 70 711
Email : info@explorasrl.net
Email : assistenza@explorasrl.net
Website : http://www.y2khosting.it/index.php

Domain Information

Domain: y2khosting.biz
Registrar: OnlineNIC, Inc. d/b/a China-channel.com
Registered On: 2004-09-06
Expires On: 2019-09-05
Updated On: 2018-08-18
Status: clientTransferProhibited
Name Servers: ns1.explora-service.it | ns2.explora-service.it

Registrant Contact

Organization: Explora S.r.l.
State: Savona
Country: IT(ALIA) | IT(ALIE) | IT(ALY)

Raw Whois Data
Domain Name: y2khosting.biz
Registry Domain ID: D7697651-BIZ
Registrar WHOIS Server:
Registrar URL: nswhois.onlinenic.com
Updated Date: 2018-08-18T05:35:20Z
Creation Date: 2004-09-06T17:14:45Z
Registry Expiry Date: 2019-09-05T23:59:59Z
Registrar: OnlineNIC, Inc. d/b/a China-channel.com
Registrar IANA ID: 82

Registrar Abuse Contact Email: abuse@onlinenic.com
Registrar Abuse Contact Phone: +1.5107698492

From: "Ameli@Assurance.CPAM.com" Ameli@Assurance.CPAM.com
Subject: *** SPAM *** Ameli Assurance - CONSULTER VOTRE DERNIER REMBOURSEMENT
To: "prenom.nom" prenom.nom@orange.fr
Content-Type: multipart/mixed; boundary=hvpABxgExYI3IOfLDLRvOJ9w8hZAt7=_E3
MIME-Version: 1.0
Date: Wed, 7 Aug 2019 15:31:09 +0200

mon-assure-gestions.com | https://mon-assure-gestions.com/formulaire

Le site Web que vous allez ouvrir est trompeur.
Des individus malveillants à l’œuvre sur le site mon-assure-gestions.com pourraient vous inciter à effectuer
des opérations dangereuses, comme installer des logiciels ou divulguer des informations personnelles (mots de passe, numéros de téléphone ou numéros de carte de crédit, par exemple).

Domain Information

Domain: mon-assure-gestions.com
Registrar: Ligne Web Services SARL dba LWS
Registered On: 2019-08-07
Expires On: 2020-08-07
Updated On: 2019-08-07
Status: clientTransferProhibited
Name Servers: cpanel13.lws-hosting.com | cpanel14.lws-hosting.com

Registrant / Administrative / Technical / Billing Contacts

Country: FR(ANCE)
Email: ef4ffd70f24588c5d80d9cdc9266f290@whois-anonymous.com

Raw Whois Data
Domain Name: mon-assure-gestions.com
Domain ID: 2420805621_DOMAIN_COM-VRSN
Sponsoring Registrar: LWS dba Ligne Web Services
Sponsoring Registrar IANA ID: 1630
Referral URL: https://www.lws.fr/
Creation Date: 2019-08-07T12:54:11Z
Updated Date: 2019-08-07T12:57:06Z
Registry Expiry Date: 2020-08-07T12:54:11Z
Domain Status: clientTransferProhibited More informations on : https://www.icann.org/epp

Registrar Abuse Contact Email: abuse@lws.fr
Registrar Abuse Contact Phone: +33.177623003

Victime de phishing :

Vous recevrez une confirmation par email une fois votre abuse traité, dans un délai approximatif de 24 à 48 heures.

En cas d'urgence, merci de nous envoyer un FAX au 09 72 12 49 84 en plus de ce formulaire via ce lien URL : https://www.lws.fr/abuse.php

Plagiat, diffamation, escroquerie ? Vous considérez que le contenu d'un site LWS ne devrait pas se trouver librement publié sur internet, et/ou qu'il poursuit des objectifs frauduleux ?

Signalez-le de cet abus auprès de l’hébergeur du site frauduleux en question :

Sàrl LWS
Société Ligne Web Services
10 rue Penthièvre
75008 Paris
Tél : 01 77 62 30 03
Email : abuse@lws.fr

Depredurand Nicolas
Ligne Web Services SARL

assurance.cpam.com | cpam.com https://www.advexplore.com/?dn=cpam.com&pid=9PO2H3067

Domain Information

Domain: cpam.com
Registrar: GoDaddy.com, LLC
Registered On: 2001-05-05
Expires On: 2020-05-05
Updated On: 2019-07-13
Status: ok
Name Servers: ns1.namefind.com | ns2.namefind.com

À PROPOS DE NAMEFIND

Nous nous sommes fait un nom dans le monde entier en tant que propriétaire de domaine en vrac spécialisé dans les noms de domaine premium. Nous savons ce qui fait qu'un domaine est un succès, ce qui nous permet de donner à nos acheteurs un domaine de premier plan qui leur permettra d'ancrer leur entreprise et d'obtenir le meilleur prix possible pour nos vendeurs.

Plus important encore, nous vous accordons l'attention personnelle que vous méritez lorsque vous investissez dans votre entreprise. Travailler avec nous signifie que vous êtes le prénom de la personne qui gère votre vente ou votre achat. Vous savez donc exactement qui appeler lorsque vous avez une question. Tout comme notre sélection de domaines, vous ne trouverez ce niveau de service personnalisé nulle part ailleurs sur le Web.

Générer un nom commercial ou trouver le bon nom pour votre produit ou projet est l’une des décisions les plus importantes que vous puissiez prendre. Un nom de marque fort permet à vos clients de trouver facilement votre entreprise ou votre site web dans l’univers numérique. L'obtention d'une bonne visibilité dans les résultats de recherche est essentielle à un bon plan de marketing numérique et entraîne une augmentation du trafic et des revenus des sites Web.

Nous hébergeons certains des noms de domaine les plus recherchés et de grande valeur de la planète. Avec une sélection de milliers de noms, notre vaste sélection couvre tous les secteurs imaginables. Quelle que soit votre activité, si vous recherchez des domaines premium à l’appel instantané et au trafic intégré, vous êtes au bon endroit.

Nous savons comment trouver les bons domaines et nous travaillons fort pour que notre inventaire soit approvisionné avec les meilleurs noms du Web. Et si vous avez des questions, nos experts de domaine sont à votre disposition pour vous aider à trouver et à acquérir le nom qui vous était destiné.

Registrant / Administrative / Technical Contacts

Organization: NameFind LLC

State: Massachusetts
Country: US(A)
Email:
Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=cpam.com

Raw Whois Data
Domain Name: cpam.com
Registry Domain ID: 70418869_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: https://fr.godaddy.com/
Updated Date: 2019-04-15T10:13:09Z
Creation Date: 2001-05-05T10:34:57Z
Registrar Registration Expiration Date: 2020-05-05T10:34:57Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146

Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505

https://www.assureo-clients.eu/service/ameli
http://assureo-clients.eu/

Domain: assureo-clients.eu

Registrant: NOT DISCLOSED!
Visit https://eurid.eu/en/ for webbased WHOIS.

Onsite(s):

NOT DISCLOSED!
Visit https://eurid.eu/en/ for webbased WHOIS.

Registrar :

Name: GoDaddy.com, LLC
Website: https://www.godaddy.com/

Name servers:

ns1.suspended-for.spam-and-abuse.com
ns2.suspended-for.spam-and-abuse.com

Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505

Please visit https://eurid.eu/en/ for more info.

Received and posted by Fraud Watcher/Advisor
Votre Commentaire / Vos ExplicationsPas concerné par l'objet de cet envoi de ce message non adressé par la CPAM (Caisse Primaire d'Assurance Maladie) pour un soi-disant remboursement de frais de santé factice.

Désormais, je constate qu'il n'affiche plus le montant de remboursement et encore moins dans le fichier (r)attaché en pièces jointes au format PDF comme auparavant.

Malgré la présence d'un cadenas pour confirmer que ce lien URL est bien sécurisé ne signifie en rien que vous êtes bien à l'abri d'un danger quelconque ou à la bonne adresse de navigation d'un site web certifié SSL pour accéder à votre compte personnel :

Cadenas MON COMPTE AMELI [Ne pas cliquer ce lien URL frauduleux sécurisé https://mon-assure-gestions.com/formulaire qui vous redirige vers un faux site non sécurisé imitant la page web d’un formulaire en ligne de la caisse primaire d’assurance maladie (CPAM | AMELI.FR) à leur insu pour usurper vos (coor)données confidentielles (identifiant, les mots de passe, code d’accès, etc) en se faisant pour vous « à votre place » auprès de la sécu pour accéder directement à votre espace perso sans que vous le sachiez].
Piece(s) jointe(s)
Pour en Savoir +Comment signaler une arnaque de Phishing ?
Tout savoir sur les arnaques au faux colis
Numéro de téléphone dangereux détecté dans ce signalement d'arnaque: Lisez cet article.
Article: Qu'est-ce que le Phishing ?
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !

1 commentaire


  • Fraud Watcher/Advisor le 10/08/2019 à 21:54

    L’Assurance Maladie met en garde les assurés sociaux contre des appels téléphoniques frauduleux et contre l'envoi de courriels frauduleux. Soyez vigilant !

    En aucun cas, vous ne devez y donner suite. Explications et conseils.

    ATTENTION AUX APPELS TÉLÉPHONIQUES FRAUDULEUX

    Des campagnes de vishing (démarchages frauduleux par téléphone) qui usurpent le nom de l'Assurance Maladie existent.

    Par exemple, lors d'un appel téléphonique se présentant comme provenant de l'Assurance Maladie, l'émetteur de l'appel laissera un message sur votre répondeur vous demandant de rappeler votre CPAM à un numéro différent du 3646. Son but est de vous faire appeler un numéro fortement surtaxé dans le but de vous soutirer de l'argent indirectement. En aucun cas, vous ne devez y donner suite.

    Nous vous rappelons que seul le 3646 vous permet de joindre votre CPAM et nous vous appelons donc à la vigilance.

    Bon à savoir : lorsque l'Assurance Maladie vous contacte par téléphone, le numéro de l'appelant qui s’affiche à l'écran de votre téléphone peut être le 3646 ou le 05 53 35 62 37 (ce numéro est un numéro officiel provenant de l'Assurance Maladie, utilisé pour des entretiens téléphoniques en vue d'améliorer la qualité de la relation avec le public et de promouvoir ses offres de service).

    Pour rappel, jamais votre interlocuteur ne vous demandera vos coordonnées bancaires (n° de compte bancaire, RIB, n° de carte bancaire...) à cette occasion.

    ATTENTION AUX COURRIELS FRAUDULEUX... Lire la suite

    Répondre
Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Italien Allemand Espagnol