Arnaque identité (Phishing) : bpfgp@mibps-bpaca.info Banque.s-Populaires

ARNAQUE SUSPECTÉE !!!

Date30/09/2019
Email frauduleuxbpfgp@mibps-bpaca.info
Pseudonyme utiliséBanque.s-Populaires
Url / Site internethttps://sparklinggmind.de/
Contenu de l'arnaqueDe : *Banque.s-Populaires* [mailto:bpfgp@mibps-bpaca.info]
PR0P264MB01073DBB72EFC657623E556180B20@PR0P264MB0107.FRAP264.PROD.OUTLOOK.COM
Envoyé : samedi 14 septembre 2019 16:00
À : prenom.nom@orange.fr
Objet : *** SPAM *** Nouveaux documents Alertes de gestion Cyberplus

1 fichier au format PDF(r)attaché en pièce(s) jointe(e) : STV-HR0002550-H.pdf (95 Ko)

Logo usurpé de la Banque Populaire Cyberplus Paiement sans autorisation officielle et à leur insu

Chèr(e)client(e)

Vous avez un nouveau message de votre conseiller,pour la consulter

Veuillez voir le document ci-joint".

Cordialement,
Banque Populaire.

ATTENTION :
Ce courriel vous est envoyé automatiquement, merci de ne pas utiliser la fonction "répondre à l'expéditeur".

---------------------------

Voici le contenu de ce fichier au format PDF(r)attaché en pièce(s) jointe(e) : STV-HR0002550-H.pdf (95 Ko)

*********MESSAGE AUTOMATIQUE**********
Logo usurpé de la BANQUE POPULAIRE sans autorisation officielle et à leur insu

PARTICULIERS | JEUNES | FONCTION PUBLIQUE | GESTION PRIVÉE | PROFESSIONNELS | ENTREPRISES
LETTRE AUX PARTICULIERS, PROFESSIONNELS, ENTREPRISES, ASSOCIATIONS.

- Vous avez reçu une alerte de sécurité sur un dysfonctionnement de vos comptes.

Nous avons par mesure de sécurité restreint le compte jusqu'à la résolution de l’incident.

Veuillez activez la fonction PassCyberPlus à travers le lien ci-desous :

Activez Maintenant
[Ne pas cliquer ce lien URL frauduleux sécurisé https://sparklinggmind.de/ qui vous redirige vers un faux site internet non sécurisé imitant la page web d'accueil de votre banque populaire supposée à leur insu pour vous voler vos (coor)données bancaires en se faisant passer pour vous "à votre place" auprès de votre banque présumée lors de la connexion de la saisie de votre identifiant et le mot de passe ainsi que code d'accès de votre compte client sans que vous le sachiez]

* CETTE VALIDATION EST IMPERATIVE POUR LA PROTECTION DE VOS DONNEES PERSONNELLES.
Cordialement
Service Relation Clientèle
BANQUE POPULAIRE

------------------------------------------------------

En-têtes Internet / Source du message :

Return-Path: bpfgp@mibps-bpaca.info

mibps-bpaca.info

Domain Information

Domain: mibps-bpaca.info
Registrar: Wild West Domains, LLC
Registered On: 2019-08-31
Expires On: 2020-08-31
Updated On: 2019-08-31
Status: clientDeleteProhibited | clientRenewProhibited | clientTransferProhibited | clientUpdateProhibited | serverTransferProhibited
Name Servers: ns1.bdm.microsoftonline.com | ns2.bdm.microsoftonline.com

Registrant Contact

Organization: Domains By Proxy, LLC
State: Arizona
Country: US(A)

Raw Whois Data
Domain Name: MIBPS-BPACA.INFO
Registry Domain ID: D503300001152593924-LRMS
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: https://www.wildwestdomains.com/
Updated Date: 2019-08-31T04:34:15Z
Creation Date: 2019-08-31T04:34:13Z
Registry Expiry Date: 2020-08-31T04:34:13Z
Registrar Registration Expiration Date:
Registrar: Wild West Domains, LLC
Registrar IANA ID: 440
Wildwest domains
14455 North Hayden Road
Suite 226
Scottsdale, AZ 85260, États-Unis
Service Clients
Support produit (24/7): +1(480) 624-2500
Fax:+1(480) 275-3996
Email : abuse@wildwestdomains.com

Signaler un abus via ce lien URL sécurisé du site internet :
https://supportcenter.secureserver.net/AbuseReport?pl_id=1387

Registrar Abuse Contact Email: abuse@wildwestdomains.com
Registrar Abuse Contact Phone: +1.4806242505

Received: from mwinf5c37 (mwinf5c37 [10.223.111.87])

Whois IP 10.223.111.87

OrgAbuseHandle: IANA-IP-ARIN
OrgAbuseName: ICANN
OrgAbusePhone: +1-310-301-5820
OrgAbuseEmail: abuse@iana.org
OrgAbuseRef: https://rdap.arin.net/registry/entity/IANA-IP-ARIN

by mwinb2z06 with LMTPA;
Sat, 14 Sep 2019 16:56:18 +0200
X-Sieve: CMU Sieve 2.3
Received: from FRA01-MR2-obe.outbound.protection.outlook.com ([40.107.9.120])

NetRange: 40.74.0.0 - 40.125.127.255
CIDR: 40.120.0.0/14, 40.76.0.0/14, 40.112.0.0/13, 40.80.0.0/12, 40.124.0.0/16, 40.125.0.0/17, 40.74.0.0/15, 40.96.0.0/12
NetName: MSFT
NetHandle: NET-40-74-0-0-1
Parent: NET40 (NET-40-0-0-0-0)
NetType: Direct Assignment
OriginAS:
Organization: Microsoft Corporation (MSFT)
RegDate: 2015-02-23
Updated: 2015-05-27
Ref: https://rdap.arin.net/registry/ip/40.74.0.0

OrgName: Microsoft Corporation
OrgId: MSFT
Address: One Microsoft Way
City: Redmond
StateProv: WA(SHINGTON)
PostalCode: 98052
Country: US(A)
RegDate: 1998-07-09
Updated: 2017-01-28

To report suspected security issues specific to traffic emanating from Microsoft online services, including the distribution of malicious content or other illicit or illegal material through a Microsoft online service, please submit reports to:

https://cert.microsoft.com

For SPAM and other abuse issues, such as Microsoft Accounts, please contact:

abuse@microsoft.com

To report security vulnerabilities in Microsoft products and services, please contact:

secure@microsoft.com

For legal and law enforcement-related requests, please contact:

msndcc@microsoft.com

For routing, peering or DNS issues, please contact:

IOC@microsoft.com

Ref: https://rdap.arin.net/registry/entity/MSFT

OrgTechHandle: MRPD-ARIN
OrgTechName: Microsoft Routing, Peering, and DNS
OrgTechPhone: +1-425-882-8080
OrgTechEmail: IOC@microsoft.com
OrgTechRef: https://rdap.arin.net/registry/entity/MRPD-ARIN

OrgAbuseHandle: MAC74-ARIN
OrgAbuseName: Microsoft Abuse Contact
OrgAbusePhone: +1-425-882-8080
OrgAbuseEmail:abuse@microsoft.com
OrgAbuseRef: https://rdap.arin.net/registry/entity/MAC74-ARIN

by mwinf5c37 with ME
id 1SwD2100s2bPXzc01SwJqQ; Sat, 14 Sep 2019 16:56:18 +0200
X-bcc: prenom.nom@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (290)(1000)gggruggvucftvghtrhhoucdtuddrgedufedrtdelgdekvdculddtuddrgeduvddrtddtmdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecugedttdenucdnrfhhihhshhhinhhgqdhfrhdqsggrnhhquhgvucdlfedttddmnefjrghmjfgvrgguvghrhfhivghlugcujfgvrgguvghrucfutghorhhinhhgucdlqddutddmnecujfgurhephffvufhtfffkihgtggesmhdttdertddtjeenucfhrhhomhepndeurghnqhhuvgdrshdqrfhophhulhgrihhrvghsndcuoegsphhfghhpsehmihgsphhsqdgsphgrtggrrdhinhhfoheqnecuffhomhgrihhnpehgohhophhitghsrdhnvghtnecukfhppeegtddruddtjedrledruddvtddpudekhedrleefrddvrdehuddpfhgvkedtmeemiegtkehfmeekhegsfhemfeeirgdtmedvjedurgenucfrrghrrghmpehhvghlohephffttedtuddqofftvddqohgsvgdrohhuthgsohhunhgurdhprhhothgvtghtihhonhdrohhuthhlohhokhdrtghomhdpihhnvghtpeegtddruddtjedrledruddvtddpmhgrihhlfhhrohhmpegsphhfghhpsehmihgsphhsqdgsphgrtggrrdhinhhfohdprhgtphhtthhopehphhhilhhiphhpvgdrtghoqhhuvghtieekjeesohhrrghnghgvrdhfrhenucevlhhushhtvghrufhiiigvpedt
X-me-spamlevel: low
X-ME-Helo: FRA01-MR2-obe.outbound.protection.outlook.com
X-ME-IP: 40.107.9.120
X-ME-Entity: ofr
ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=h+2BYTquFcE+ThQqtjbkTzmGKyfFBtuq7picnIsBSxbEOvENzlZ+OwYS4Bd1TN93SEb5uY7YpfQiY+r+I6uwjqJ0m4ASPO0DktnB7YIHwHOMIXT/1hPdR06KZrt0hIjBVZmk8h9Z+8ewKz+rxc7sm2zaZfK/K0odp9ukB0LgGmUv23bSemWIn4QOTESHflsfLXe/blwTaIRyNykZezAOEBQ/DBqsVkzUj/GCCwemtz0ZMnY/qmODe8iILvhSwAEXEkUKGPZOJRFOY/0IHxvFf/pLdQIgxnnTvvy8Xpp8ItmK2w6Yi1u/oPFXlU6kR99qpO5gmlvtVkL49w305FV1tg==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com;
s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=A+poMLj0GRxtWGT795cS4EUjVEq5g+Ujpn3Bsb8V1BQ=; b=Hdk0QSR1D/Wu0YO/C15kX8EniQYo6FPIKBfR/TUD82tRj7WhiUM6manSxh8JgRNFezTUhmmf6h1Ri++P7ckgw3SDS0xLsRfwHmVliMOcYA5tccXZgT+MCGHj4AFY8/PykiaiEYssdRnn0eXrTiMa5VJRe0pZw/YEAoGnC1wNkVHhg0xP1Fo0KkHAFao+chhoGzx1NWOKwfdx15H9nViua64qmbpvb75JN4Ct+Q9DcGexBzECa1yRH1l30eI6dUOXzg1iZnOGjrP7lBabeuRFh/wudRXlkSu3HfWhpNAKSB5Sn+veLNA1XvjCWzMMDpZY9RSMFztK3pyviYo+Lrx6RQ=ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass
smtp.mailfrom=mibps-bpaca.info; dmarc=pass action=none header.from=mibps-bpaca.info; dkim=pass header.d=mibps-bpaca.info; arc=none DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=amlia.onmicrosoft.com; s=selector2-amlia-onmicrosoft-com; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=A+poMLj0GRxtWGT795cS4EUjVEq5g+Ujpn3Bsb8V1BQ=; b=TmPVzPF2SX5bOwddq7vjWk6J6jM3WQ+ldzplhPOQyTh77nz7xAUzuvpwz3qJ9pPWnhw19kmQwqIL4QFQDIOy/sKlTwxZRy6leQG+oRFD6aoiAyQoTyvj+JSVVwXkBzLPxQm2WzLU5OmF0ucwaWNiXAXtUY+3XJKzbZB6qY8AA2s=
Received: from PR0P264MB0107.FRAP264.PROD.OUTLOOK.COM (52.133.65.151) by

Whois IP 52.133.65.151

For SPAM and other abuse issues, such as Microsoft Accounts, please contact:

abuse@microsoft.com.

PR0P264MB0652.FRAP264.PROD.OUTLOOK.COM (52.133.71.138) with Microsoft SMTP
Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id
15.20.2263.21; Sat, 14 Sep 2019 14:56:14 +0000
Received: from PR0P264MB0107.FRAP264.PROD.OUTLOOK.COM
([fe80::6c8f:85bf:36a0:271a]) by PR0P264MB0107.FRAP264.PROD.OUTLOOK.COM
([fe80::6c8f:85bf:36a0:271a%6]) with mapi id 15.20.2263.023; Sat, 14 Sep 2019 14:56:14 +0000
From: *Banque.s-Populaires* bpfgp@mibps-bpaca.info
To: "prenom.nom@orange.fr" prenom.nom@orange.fr
Subject: *** SPAM *** Nouveaux documents Alertes de gestion Cyberplus
Thread-Topic: Nouveaux documents Alertes de gestion Cyberplus
Thread-Index: AQHVawS1up8cheQnJky3jiIJw6Nv6w==
Date: Sat, 14 Sep 2019 14:00:04 +0000
Message-ID:
PR0P264MB01073DBB72EFC657623E556180B20@PR0P264MB0107.FRAP264.PROD.OUTLOOK.COM
Accept-Language: fr-FR, en-US
Content-Language: en-US
X-MS-Has-Attach: yes
X-MS-TNEF-Correlator:
x-clientproxiedby: CWXP265CA0066.GBRP265.PROD.OUTLOOK.COM
(2603:10a6:400:2c::30) To PR0P264MB0107.FRAP264.PROD.OUTLOOK.COM
(2603:10a6:100:3::23)
authentication-results: spf=none (sender IP is )
smtp.mailfrom=bpfgp@mibps-bpaca.info;
x-ms-exchange-messagesentrepresentingtype: 1
x-originating-ip: [185.93.2.51]

Whois IP 185.93.2.51

Information related to 185.93.2.0 - 185.93.2.255

Abuse contact for 185.93.2.0 - 185.93.2.255 is abuse@cdn77.com

inetnum: 185.93.2.0 - 185.93.2.255
netname: CDN77-PARIS-1
descr: CDN77.com
country: FR(ANCE)
admin-c: ZC619-RIPE
tech-c: ZC619-RIPE
status: ASSIGNED PA
mnt-by: DATACAMP-MNT
mnt-lower: DATACAMP-MNT
mnt-routes: DATACAMP-MNT
created: 2015-03-25T11:27:36Z
last-modified: 2017-11-13T09:53:45Z
source: RIPE

person(ne): Zdenek Cendra, Founder & CEO
https://www.crunchbase.com/person/zdenek-cendra
https://cz.linkedin.com/in/cendra

Zdenek Cendra
@zdendac
Founder: https://www.cdn77.com/
, https://www.superhosting.cz/, https://datapacket.com/ and Co-founder: https://www.peering.cz/ and https://cocopacket.com/
https://twitter.com/zdendac
Prague
https://twitter.com/zdendac
Inscrit en mai 2011

DataCamp Limited
207 Regent Street
London W1B 3HH, United Kingdom
Tel : +44(0)20 3289 6746 (UK)
Email : datacamp@datacamp.co.uk
Email : support@cdn77.com
Site web : https://www.datacamp.co.uk/
Site web : https://www.cdn77.com/
Skype ID : CDN77

European & Global Sales
Katerina Omelkova
Email : katerina.omelkova@cdn77.com
Skype ID : katerina@cdn77

Global Marketing
Veronika Minovska
Email : veronica@cdn77.com

nic-hdl: ZC619-RIPE
created: 2014-03-17T12:12:23Z
last-modified: 2017-10-30T22:33:42Z
source: RIPE # Filtered
mnt-by: SUPERNETWORK-MNT
Tel : +17184279911

Information related to 185.93.2.0/24AS60068

route: 185.93.2.0/24
descr: CDN77 - Paris POP
origin: AS60068
mnt-by: DATACAMP-MNT
created: 2015-03-25T11:28:57Z
last-modified: 2015-03-25T11:28:57Z
source: RIPE

x-ms-publictraffictype: Email
x-ms-office365-filtering-correlation-id: a53190ca-cb62-4672-3ee1-08d7391bd76b
x-microsoft-antispam:
BCL:0;PCL:0;RULEID:(2390118)(7020095)(4652040)(8989299)(4534185)(4627221)(201703031133081)(201702281549075)(8990200)(5600166)(711020)(4605104)(1401327)(2017052603328)(49563074)(7193020);SRVR:PR0P264MB0652;
x-ms-traffictypediagnostic: PR0P264MB0652:
x-microsoft-antispam-prvs:
PR0P264MB0652B941FC49E5FB4975A95F80B20@PR0P264MB0652.FRAP264.PROD.OUTLOOK.COM
x-ms-oob-tlc-oobclassifiers: OLM:1051;
x-forefront-prvs: 01604FB62B
x-forefront-antispam-report:
SFV:NSPM;SFS:(10019020)(4636009)(39860400002)(366004)(376002)(346002)(396003)(136003)(199004)(189003)(6436002)(7736002)(102836004)(81156014)(81166006)(8676002)(316002)(53936002)(15650500001)(19627235002)(26005)(6916009)(8936002)(2501003)(2906002)(74316002)(99936001)(86362001)(5660300002)(386003)(2351001)(6506007)(186003)(256004)(478600001)(66066001)(71200400001)(71190400001)(52536014)(25786009)(6666004)(55016002)(14454004)(6306002)(52116002)(54896002)(6116002)(9686003)(7696005)(33656002)(66946007)(66616009)(66476007)(66556008)(64756008)(66446008)(3846002)(5640700003)(733005)(558084003)(99286004)(486006)(476003);DIR:OUT;SFP:1102;SCL:1;SRVR:PR0P264MB0652;H:PR0P264MB0107.FRAP264.PROD.OUTLOOK.COM;FPR:;SPF:None;LANG:fr;PTR:InfoNoRecords;A:0;MX:1;
received-spf: None (protection.outlook.com: mibps-bpaca.info does not
designate permitted sender hosts)
x-ms-exchange-senderadcheck: 1
x-microsoft-antispam-message-info:
o/FeSZ3PqU133xcGnreL547CR2dpvuNTLCGpwsz+SMFyoVeVKpb7+dRr0MULSNNNnmfZS4Mhlg+vipb+8JAYfj+ygjMBP/TDpTUYpngem1a1t6+8Bg6jaJYuCYZ2s1ONKWspyoRVBq2VpZLjVgqr+Yin6YxkeJndKf/N19003iKoSjeHY2Qr8zU4WpXJ24gOzUnv1Y6qjf4LwXITIZ5cU1gS5+zKapNzzi8woEDq8hejp1Gqa0wzatjdi67VZNWpZAd5ysj4Rfv2fBq4OsN2BniyclvhgAJlh9HlB0HLjjCRCB8m+hrFN3co1br5s/JsSQ8yl8Aep/jVZCo8PVwpY5UxfJWcSOurvUExw9DtkPLExpIB8ed5U/Wr3v9jBpNRdQW04/ge0OdpROcRnjeOwG28FK1f/sq6r7FAvOB98go=
x-ms-exchange-transport-forked: True
Content-Type: multipart/mixed;
boundary="_004_PR0P264MB01073DBB72EFC657623E556180B20PR0P264MB0107FRAP_"
MIME-Version: 1.0
X-OriginatorOrg: mibps-bpaca.info
X-MS-Exchange-CrossTenant-Network-Message-Id: a53190ca-cb62-4672-3ee1-08d7391bd76b
X-MS-Exchange-CrossTenant-originalarrivaltime: 14 Sep 2019 14:00:04.0832
(UTC)
X-MS-Exchange-CrossTenant-fromentityheader: Hosted
X-MS-Exchange-CrossTenant-id: 8dbc8e36-4da9-476e-ad78-73a8beff74bf
X-MS-Exchange-CrossTenant-mailboxtype: HOSTED
X-MS-Exchange-CrossTenant-userprincipalname: vTLbBzWbemsLIlMWlyPxlRSu7BhDRl3XvkRxUxOHVjrZR+J6Sw4MyYEzsEvHPzRgq6I5tAhHQTaYFhNXtUirpg==
X-MS-Exchange-Transport-CrossTenantHeadersStamped: PR0P264MB0652

Received and posted by Fraud Watcher/Advisor
Commentaire / ExplicationsPas concerné par l’objet de cet envoi de ce message vu que je ne suis pas client à cette banque en question

Signature classique d’une arnaque au phishing qui consiste à vous voler vos (coor)données bancaires au moment de se connecter en ligne lors de votre saisie, à savoir votre identifiant, le mot de passe et le code d'accès dans le seul but d'accéder directement à votre compte client en se faisant passer pour vous "à votre place" auprès de votre banque supposée et à leur insu.

Pour signaler des problèmes de sécurité spécifiques au trafic émanant de services en ligne, notamment la diffusion de contenus malveillants ou d'autres contenus illicites ou illégaux via un service en ligne, veuillez envoyer des rapports à:

abuse@wildwestdomains.com

abus@microsoft.com

abuse@cdn77.com
Piece(s) jointe(s)
Pour en Savoir +Comment signaler une arnaque de Phishing ?
Numéro de téléphone dangereux détecté dans ce signalement d'arnaque: Lisez cet article.
Article: Qu'est-ce que le Phishing ?
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !

1 commentaire


  • Fraud Watcher/Advisor le 30/09/2019 à 20:18

    Restez informé des dernières alertes de sécurité.

    Des pirates informatiques tentent régulièrement d'escroquer des clients Banque Populaire.

    Client, vous pensez avoir été victime d'une fraude ?

    Contactez immédiatement votre interlocuteur habituel.
    Il vous indiquera les actions à entreprendre.

    Signaler un contenu frauduleux

    Votre signalement protégera les clients Banque Populaire de cette tentative de fraude. Vous contribuez ainsi à lutter contre la cybercriminalité. Merci !

    Pour ce faire, merci d'utiliser le formulaire dédié sur le(ur) site national des banques populaires via ce lien URL sécurisé :

    https://www.banquepopulaire.fr/portailinternet/Editorial/Informations/Pages/Securite.aspx

    Répondre
Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Italien Allemand Espagnol