Arnaque de loterie : andrea.piscitelli@skymesh.com.au

ARNAQUE SUSPECTÉE !!!

Date14/07/2020
Email frauduleuxandrea.piscitelli@skymesh.com.au
Contenu de l'arnaqueReturn-Path:
Received: from opme11dod01nd1.rouen.francetelecom.fr ([10.79.5.103])
by opme11dob75nd1.rouen.francetelecom.fr with LMTP id YGBADr7QDV89awAAQkyOOg
; Tue, 14 Jul 2020 17:35:26 +0200
Received: from opme11ppr04nd1.rouen.francetelecom.fr ([10.79.5.103])
by opme11dod01nd1.rouen.francetelecom.fr with LMTP id UD3sDb7QDV/1bgAADLpaYw
; Tue, 14 Jul 2020 17:35:26 +0200
Received: from mwinf5c48 ([10.79.5.103])
by opme11ppr04nd1.rouen.francetelecom.fr with LMTP id QFDzJrzQDV/OJAAA0RCFVw
; Tue, 14 Jul 2020 17:35:26 +0200
Received: from mail-smtp3.skymesh.net.au ([210.16.69.71])
by mwinf5c48 with ME
id 33ZM2300W1YFhH6013bEyJ; Tue, 14 Jul 2020 17:35:26 +0200
X-bcc: gerard.jacques@wanadoo.fr
X-ME-bounce-domain: wanadoo.fr
X-ME-engine: default
X-me-spamcause: (40)(0000)gggruggvucftvghtrhhoucdtuddrgeduiedrfedtgdelvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecugedttdenucgouhhnughishgtlhhoshgvugculdegtddmnecujfgurhepgggtfffhufgjfhfkgigfsehmtdhjredtreejnecuhfhrohhmpegrnhgurhgvrgdrphhishgtihhtvghllhhisehskhihmhgvshhhrdgtohhmrdgruhenucggtffrrghtthgvrhhnpeetvdefieekleeghfeugeehkeekgfekgfettdekudejleekgeehkeejjeeffeekhfenucfkphepvddutddrudeirdeiledrjedupddvuddtrdduiedrieelrdeiieenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopehmrghilhdqshhmthhpfedrshhkhihmvghshhdrnhgvthdrrghupdhinhgvthepvddutddrudeirdeiledrjedupdhmrghilhhfrhhomheprghnughrvggrrdhpihhstghithgvlhhlihesshhkhihmvghshhdrtghomhdrrghupdhrtghpthhtohepvghlohhivgdrmhgrihhrihgvseifrghnrgguohhordhfrhdprhgtphhtthhopehfmhhjrgesfigrnhgrughoohdrfhhrpdhrtghpthhtohepghgvnhgvvhhivghvvgdruggvqdhluhiirghnseifrghnrgguohhordhfrhdprhgtphhtthhopehgvghrrghrugdrjhgrtghquhgvshdujeesfigrnhgrughoohdrfhhrpdhrtghpthhtohepghgvrhgrrh
X-me-spamlevel: not-spam
X-ME-Helo: mail-smtp3.skymesh.net.au
X-ME-IP: 210.16.69.71
X-ME-Entity: ofr
Received: from webmail.skymesh.net.au (mail-www2.skymesh.net.au [210.16.69.66])
by mail-smtp3.skymesh.net.au (Postfix) with ESMTP id CDD662E1EA1;
Tue, 14 Jul 2020 15:33:15 +0000 (UTC)
MIME-Version: 1.0
Content-Type: multipart/mixed;
boundary="=_75baf178e217416db4897375607b52f8"
Date: Tue, 14 Jul 2020 15:33:15 +0000
From: andrea.piscitelli@skymesh.com.au
To: undisclosed-recipients:;
Subject: =?UTF-8?Q?R=C3=A9=C3=A9cIamation-F=27D=27J?=
In-Reply-To:
References:

Message-ID:
X-Sender: andrea.piscitelli@skymesh.com.au
User-Agent: Roundcube Webmail/1.2.3
X-Antivirus: avast! (VPS 200714-0, 14/07/2020), Inbound message
X-Antivirus-Status: Clean
Commentaire / ExplicationsLe message :

> >> Bonjour Mr/Mme,

Veuillez trouver les détails du tirage2020 en annexe joint.

Cordialement
Pour en Savoir +Le SPAM est largement utilisé pour diffuser des arnaques, comment ça marche ?
Se faire rembourser en cas d'arnaque, c'est possible avec le Chargeback !
Arnaques de loteries: Comprenez leur fonctionnement !
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !

1 commentaire


  • Fraud Watcher/Advisor le 14/07/2020 à 20:31

    A l'@ttn de Jacques GERARD à propos de ces adresses IP addresses: 210.16.69.71 | 210.16.69.66 qui confirment l’origine de sa provenance via un fournisseur d’accès internet basé à Fortitude Valley en Australie :

    Pour les problèmes de piratage informatique, d’abus frauduleux, de spam ou de sécurité, veuillez signaler et transférez nous cet email suspect en l'état grâce au bouton "transfert" de votre messagerie à cette adresse email officielle :

    abuse@skymesh.net.au

    Information related to 210.16.68.0 - 210.16.71.255

    Abuse contact for 210.16.68.0 - 210.16.71.255 is abuse@skymesh.net.au

    inetnum: 210.16.68.0 - 210.16.71.255
    netname: SkyMesh

    Au sujet de…

    SkyMesh est une entreprise de télécommunications et un FAI australien appartenant à Bigblu Broadband qui fournit des services NBN, sans fil et par satellite, ainsi que des services par satellite IPSTAR hérités. SkyMesh est basée à Fortitude Valley, Queensland (QLD), Australie.... Lire la suite

    • Fraud Watcher/Advisorle 14/07/2020 à 20:40

      Si l'escroc (@lias l’expéditeur ou l'utilisateur factice) dispose d'une adresse email usurpée ou falsifiée qui se termine par @skymesh.com.au, signalez l'abus si vous avez reçu un message suspect estampillé à l'en-tête d'un courriel afin que l'auteur de cette arnaque soit identifié et bloqué, veuillez transférer l'email frauduleux à cette adresse suivante :

      abuse@skymesh.net.au

      SkyMesh Pty Ltd
      Licensed Telecommunications Carrier
      ABN 62 113 609 439
      47 Baxter Street
      Fortitude Valley, QLD 4006, Australia
      Tel: +61 7 3123 5807 | +61 414 663 053
      Fax: +61 7 3032 5755
      Email: hostmaster@skymesh.net.au | apnic-org@skymesh.net.au |
      terry@staff.skymesh.net.au | tcsweetser@gmail.com
      Website: https://www.skymesh.net.au

    Répondre

 
 
 

Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Espagnol Italien Allemand