Arnaque identité (Phishing) : anne.gavard2@orange.fr Opinion d'E.Leclerc

ARNAQUE SUSPECTÉE !!!

Date07/09/2020
Email frauduleuxanne.gavard2@orange.fr
Pseudonyme utiliséOpinion d'E.Leclerc
Contenu de l'arnaqueSubject : Toutes nos félicitations! Vous pouvez obtenir une carte-cadeau E.Leclerc de 50 €!

Date : Mon, 07 Sep 2020 10:15:00 GMT

From : Opinion d'E.Leclerc

To : Anne Gavard

Content-Type : multipart/alternative

Feedback-ID : 2808:groups_you_should_join:Facebook

Message-ID :

MIME-Version : 1.0

X-OX-Marker : af3aee19-abb6-43b3-bdc4-5099bd01a71f

Received : from opme11dod05nd1.rouen.francetelecom.fr ([10.79.5.103]) by opme11dob22nd1.rouen.francetelecom.fr with LMTP id 4FOVNiwIVl/HPQAArIdEtQ ; Mon, 07 Sep 2020 12:15:08 +0200,from opme11ppr08nd1.rouen.francetelecom.fr ([10.79.5.103]) by opme11dod05nd1.rouen.francetelecom.fr with LMTP id iAmINiwIVl/6EAAAMyWfjw ; Mon, 07 Sep 2020 12:15:08 +0200,from mwinf5c35 ([10.79.5.103]) by opme11ppr08nd1.rouen.francetelecom.fr with LMTP id YIrlGygIVl95FAAA4eDulA ; Mon, 07 Sep 2020 12:15:08 +0200,from lstlambert-657-1-125-211.w92-154.abo.wanadoo.fr ([116.193.78.57]) by mwinf5c35 with ME id Qy6R2300p1EBCxQ01yF2ob; Mon, 07 Sep 2020 12:15:03 +0200,from mwinf5c17 (mwinf5c17 [10.223.111.67]) by mwinb2j04 with LMTPA; Thu, 09 Jul 2020 13:01:59 +0200,from 69-171-232-138.mail-mail.facebook.com ([69.171.232.138]) by mwinf5c17 with ME id 0z1w2300D2zpNDR01z1z6R; Thu, 09 Jul 2020 13:01:59 +0200

X-ME-Entity : ofr,ofr

DKIM-Signature : v=1; a=rsa-sha256; c=relaxed/simple; d=facebookmail.com; s=s1024-2013-q3; t=1594292513; bh=1cvvlK/d3YkEv4jmmm4LRXO+ofAMnAcoBtxNtQEkR7E=; h=Date:To:Subject:From:MIME-Version:Content-Type; b=FToPlZ8brymnFovF2fQ2xArHrIfTcravo4LjWq03ZXv1k6KVBQ0bc9uVUDZ6Zov2d DRYAKVX0QDLfcsI+/galnEX53tjkIxt97ARYDGgYkbgvuzD+g9Nhcn/aHMfrCSeeFF mVU570AgG/l835yTXQyqlD+w4We7cAMd5GahyptA=

X-me-spamlevel : not-spam,med

X-ME-bounce-domain : orange.fr

X-ME-engine : default,default

X-bcc : anne.gavard2@orange.fr,b.lestoquoy@orange.fr

X-Auto-Response-Suppress : All

X-FACEBOOK-PRIORITY : 1

X-Mailer : ZuckMail [version 1.00]

X-Facebook-Notify : groups_you_should_join; mailid=5a9ffdd4de55fG5ef0d0bfG5aa0026e3e831G7c1

X-Sieve : CMU Sieve 2.3

X-ME-IP : 116.193.78.57

X-ME-Helo : lstlambert-657-1-125-211.w92-154.abo.wanadoo.fr

X-Facebook : from 2401:db00:2020:a014:face:0:26:0 ([MTI3LjAuMC4x]) by async with HTTPS (ZuckMail);

List-Unsubscribe :

X-me-spamcause : (10)(0013)gggruggvucftvghtrhhoucdtuddrgeduiedrudelgdefhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecugedttdenucfuohgtihgrlhfpvghtfihorhhkqddqhfgrtggvsghoohhkucdluddtmdenucfjughrpeffvffurffohfhrvgfjkfggtgesrgdtjhhpredtjeenucfhrhhomhepfdfhrggtvggsohhokhdfuceonhhothhifhhitggrthhiohhnsehfrggtvggsohhokhhmrghilhdrtghomheqnecuggftrfgrthhtvghrnhepleeijeejvddtjeeivefhheffueegvddtveevteetuedtieehudegjeefiefggfdunecuffhomhgrihhnpehfrggtvggsohhokhdrtghomhenucfkphepieelrddujedurddvfedvrddufeeknecuvehluhhsthgvrhfuihiivgepkeefnecurfgrrhgrmhephhgvlhhopeeiledqudejuddqvdefvddqudefkedrmhgrihhlqdhmrghilhdrfhgrtggvsghoohhkrdgtohhmpdhinhgvthepieelrddujedurddvfedvrddufeekpdhmrghilhhfrhhomhepnhhothhifhhitggrthhiohhnsehfrggtvggsohhokhhmrghilhdrtghomhdprhgtphhtthhopegrnhhnvgdrghgrvhgrrhguvdesohhrrghnghgvrdhfrh,(400)(1000)gggruggvucftvghtrhhoucdtuddrgeduiedrudehtddgvdejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrihhlohhuthemucegtddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenogfhohhrsghiugguvghnffhomhgrihhnucdlhedttddmnecujfgurhepfffvuffroffhrhgvjffkgggtsegrtdhjphertdejnecuhfhrohhmpedfqfhpihhnihhonhcuugdkgfdrnfgvtghlvghrtgcufdcuoehnohhtihhfihgtrghtihhonhesfhgrtggvsghoohhkmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeejhfdvhedvgeduieeiffeuueeijeejfeduheekieevtdfhtdetgefhieevieekkeenucffohhmrghinheprhgvtggrphhtuhhrvgdrlhhinhhkpdhfrggtvggsohhokhdrtghomhenucfkphepudduiedrudelfedrjeekrdehjedpieelrddujedurddvfedvrddufeeknecuufhprghmkfhppfgvthifohhrkhepudduiedrudelfedrjeekrdehjeenucfhohhrsghiugguvghnffhomhgrihhnpehrvggtrghpthhurhgvrdhlihhnkhenucfuphgrmhfgmhgrihhlpegrnhhnvgdrghgrvhgrrhguvdesohhrrghnghgvrdhfrhenucfuphgrmhfuuhgsjhgvtghtpefvohhuthgvshcunhhoshcufhorlhhitghithgrthhiohhnshcvucggohhushcuphhouhhvvgiiuchosghtvghnihhruchunhgvucgtrghrth

Errors-To : notification@facebookmail.com

X-Me-Spamwebmail : SPAM-FROM

Require-Recipient-Valid-Since : anne.gavard2@orange.fr; Monday, 15 Jun 2009 18:14:14 +0000

Reply-To : noreply

Return-Path : ,

“”

L'annonceur ne gère pas votre abonnement.
Si vous ne recevez plus la communication qui va se flétrir et que vous la recevez, vous pouvez vous désinscrire ici
Ou écrivez à : PO Box 7775,,PMB 78292, San Francisco, California , 94120-7775

Le vide-grenier du collectif Paris XX
0 amis · 4K membres
Wanted Community Vide-Dressing et Beauté Paris
0 amis · 109K membres
Accéder au groupe
Accéder au groupe

Collectif Paris 19 : Echanges, Partages, Infos, Bons Plans, Solidarité.
0 amis · 9K membres

Wanted Community Paris
0 amis · 498K membres
Accéder au groupe
Accéder au groupe
Découvrir plus de groupes
Commentaire / ExplicationsVraiment pénible d'avoir sa messagerie saturée par ces spams destinés à anne.gavard2@orange.fr.
Plusieurs signalements quotidiens sur le site "Signal Spam"... mais est-ce vraiment utile ?
Piece(s) jointe(s)
Autres Référenceshttps://www.signal-arnaques.com/scam/view/272788 (57 commentaires)
https://www.signal-arnaques.com/scam/view/278096 (4 commentaires)
https://www.signal-arnaques.com/scam/view/279842 (2 commentaires)
https://www.signal-arnaques.com/scam/view/270557 (8 commentaires)
Pour en Savoir +Le SPAM est largement utilisé pour diffuser des arnaques, comment ça marche ?
Se faire rembourser en cas d'arnaque, c'est possible avec le Chargeback !
Comment signaler une arnaque de Phishing ?
Arnaques sur Facebook: Suivez le guide !
Numéro de téléphone dangereux détecté dans ce signalement d'arnaque: Lisez cet article.
Article: Qu'est-ce que le Phishing ?
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !

14 commentaires


 
 
 

Votre commentaire sera mis en ligne
immédiatement après votre validation