Arnaque de loterie : anne.gavard2@orange.fr 0688481626 contact@newsletter.3suisses.fr

ARNAQUE SUSPECTÉE !!!

Date16/09/2020
Email frauduleuxanne.gavard2@orange.fr
Pseudonyme utilisécontact@newsletter.3suisses.fr
Téléphone06 88 48 16 26 (+ d'infos)
Contenu de l'arnaqueReturn-Path:
Received: from mwinf5c60 (mwinf5c60 [10.223.111.110])
by mwinb2w05 with LMTPA;
Tue, 15 Sep 2020 23:28:49 +0200
X-Sieve: CMU Sieve 2.3
Received: from lstlambert-657-1-125-211.w92-154.abo.wanadoo.fr ([185.169.4.179])
by mwinf5c60 with ME
id UMUj2300C3rklLx01MUjvD; Tue, 15 Sep 2020 23:28:44 +0200
X-bcc: serge-etienne@wanadoo.fr
X-ME-engine: default
X-me-spamcause: (400)(1000)gggruggvucftvghtrhhoucdtuddrgedujedrtddtgddufeduucdltddurdegudeirddttddmucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrihhlohhuthemucegtddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenogfhohhrsghiugguvghnffhomhgrihhnucdlhedttddmnecujfgurhepfffvuffroffhrhgvjffkgggtsegrtdhjphertdejnecuhfhrohhmpedfqfhrrghnghgvfdcuoehnohhtihhfihgtrghtihhonhesfhgrtggvsghoohhkmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeejtdegtdeigfeuvdefieellefhkeekfffgfffglefffeekledvtdevveeigfevleenucffohhmrghinheprhgvtggrphhtuhhrvgdrlhhinhhkpdhfrggtvggsohhokhdrtghomhenucfkphepudekhedrudeiledrgedrudejledpieelrddujedurddvfedvrddufeeknecuufhprghmkfhppedukeehrdduieelrdegrddujeelnecuufhprghmkfhppfgvthifohhrkhepudekhedrudeiledrgedrudejleenucfhohhrsghiugguvghnffhomhgrihhnpehrvggtrghpthhurhgvrdhlihhnkhenucfuphgrmhfgmhgrihhlpegrnhhnvgdrghgrvhgrrhguvdesohhrrghnghgvrdhfrhenucfuphgrmhetlhhphhgrufhusghjvggtthepjihnrghmvgiljihnrghmvgilrghvihhsfhhinhgrlhijuggrthgvlienuc
X-me-spamlevel: med
X-ME-Helo: lstlambert-657-1-125-211.w92-154.abo.wanadoo.fr
X-ME-IP: 185.169.4.179
X-ME-Entity: ofr
Received: from mwinf5c17 (mwinf5c17 [10.223.111.67])
by mwinb2j04 with LMTPA;
Thu, 09 Jul 2020 13:01:59 +0200
X-Sieve: CMU Sieve 2.3
Received: from 69-171-232-138.mail-mail.facebook.com ([69.171.232.138])
by mwinf5c17 with ME
id 0z1w2300D2zpNDR01z1z6R; Thu, 09 Jul 2020 13:01:59 +0200
X-bcc: anne.gavard2@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (10)(0013)gggruggvucftvghtrhhoucdtuddrgeduiedrudelgdefhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecugedttdenucfuohgtihgrlhfpvghtfihorhhkqddqhfgrtggvsghoohhkucdluddtmdenucfjughrpeffvffurffohfhrvgfjkfggtgesrgdtjhhpredtjeenucfhrhhomhepfdfhrggtvggsohhokhdfuceonhhothhifhhitggrthhiohhnsehfrggtvggsohhokhhmrghilhdrtghomheqnecuggftrfgrthhtvghrnhepleeijeejvddtjeeivefhheffueegvddtveevteetuedtieehudegjeefiefggfdunecuffhomhgrihhnpehfrggtvggsohhokhdrtghomhenucfkphepieelrddujedurddvfedvrddufeeknecuvehluhhsthgvrhfuihiivgepkeefnecurfgrrhgrmhephhgvlhhopeeiledqudejuddqvdefvddqudefkedrmhgrihhlqdhmrghilhdrfhgrtggvsghoohhkrdgtohhmpdhinhgvthepieelrddujedurddvfedvrddufeekpdhmrghilhhfrhhomhepnhhothhifhhitggrthhiohhnsehfrggtvggsohhokhhmrghilhdrtghomhdprhgtphhtthhopegrnhhnvgdrghgrvhgrrhguvdesohhrrghnghgvrdhfrh
X-me-spamlevel: not-spam
X-ME-Entity: ofr
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=facebookmail.com;
s=s1024-2013-q3; t=1594292513;
bh=1cvvlK/d3YkEv4jmmm4LRXO+ofAMnAcoBtxNtQEkR7E=;
h=Date:To:Subject:From:MIME-Version:Content-Type;
b=FToPlZ8brymnFovF2fQ2xArHrIfTcravo4LjWq03ZXv1k6KVBQ0bc9uVUDZ6Zov2d
DRYAKVX0QDLfcsI+/galnEX53tjkIxt97ARYDGgYkbgvuzD+g9Nhcn/aHMfrCSeeFF
mVU570AgG/l835yTXQyqlD+w4We7cAMd5GahyptA=
X-Facebook: from 2401:db00:2020:a014:face:0:26:0 ([MTI3LjAuMC4x])
by async with HTTPS (ZuckMail);
Date: Tue, 15 Sep 2020 17:28:42 -0400 (EDT)
To: Anne Gavard
Subject: *** SPAM *** Serge-etienne Avis Final :16-09-2020
X-Priority: 3
X-Mailer: ZuckMail [version 1.00]
From: "Orange"
Reply-to: noreply
Errors-To: notification@facebookmail.com
X-Facebook-Notify: groups_you_should_join; mailid=5a9ffdd4de55fG5ef0d0bfG5aa0026e3e831G7c1
List-Unsubscribe:
Feedback-ID: 2808:groups_you_should_join:Facebook
X-FACEBOOK-PRIORITY: 1
X-Auto-Response-Suppress: All
Require-Recipient-Valid-Since: anne.gavard2@orange.fr; Monday, 15 Jun 2009 18:14:14 +0000
Message-ID:
MIME-Version: 1.0
Content-Type: multipart/alternative;
boundary="b1_28810ef8e4ca118f6a80db665c352206"

--b1_28810ef8e4ca118f6a80db665c352206
Content-Type: text/plain; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

Bonjour Anne,

Merci,
L=E2=80=99=C3=A9quipe Facebook

=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=
=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D
Ce message a =C3=A9tFacebook@media all and (max-width=
: 480px){*[class].ib_t{min-width:0% !important}*[class].ib_row{display:bloc=
k !important}*[class].ib_ext{display:block !important;padding:0px 0 0px 0;v=
ertical-align:top !important;width:0% !important}*[class].ib_img,*[class].i=
b_mid{vertical-align:top !important}*[class].mb_blk{display:block !importan=
t;padding-bottom:0px;width:0% !important}*[class].mb_hide{display:none !imp=
ortant}*[class].mb_inl{display:inline !important}*[class].d_mb_flex{display=
:block !important}}.d_mb_show{display:none}.d_mb_show_center{display:table;=
margin:auto}.d_mb_flex{display:flex}@media only screen and (max-device-widt=
h: 480px){.d_mb_hide{display:none !important}.d_mb_show{display:block !impo=
rtant}.d_mb_flex{display:block !important}}.mb_text h1,.mb_text h2,.mb_text=
h3,.mb_text h4,.mb_text h5,.mb_text h6{line-height:normal}.mb_work_text h1=
{font-size:0px;line-height:normal;margin-top:0px}.mb_work_text h2,.mb_work_=
text h3{font-size:0px;line-height:normal;margin-top:0px}.mb_work_text h4,.m=
b_work_text h5,.mb_work_text h6{font-size:0px;line-height:normal}.mb_work_t=
ext a{color:#1270e9}.mb_work_text p{margin-top:0px} Anne, rejoignez des groupes pour communiq=
uer avec des personnes qui partagent vos centres d=E2=80=99int=C3=A9r=C3=
=AAt. Facebook Rejoignez des groupes pour comm=
uniquer avec des personnes qui partagent vos centres d=E2=80=99int=C3=A9r=
=C3=AAt.NOUS VOUS RECOMMANDONS=

Obtenez une carte cadeau de 50=E2=82=AC d'A=
mazon !
Commentaire / ExplicationsVisiblement signalé plusieurs fois.
Autres Référenceshttps://www.signal-arnaques.com/scam/view/270807
https://www.signal-arnaques.com/scam/view/272788
https://www.signal-arnaques.com/scam/view/270557
https://www.signal-arnaques.com/scam/view/270532
Pour en Savoir +Se faire rembourser en cas d'arnaque, c'est possible avec le Chargeback !
Arnaques sur Facebook: Suivez le guide !
Numéro de téléphone dangereux détecté dans ce signalement d'arnaque: Lisez cet article.
Arnaques de loteries: Comprenez leur fonctionnement !
Que faire en cas d'Arnaque ? Il n'est peut-être pas trop tard...
Alertez vos Amis !

Analyse du numéro de téléphone 06 88 48 16 26

Type de numéroNuméro mobile
Formats usuels
  • 0688481626
  • 06 88 48 16 26
  • 06.88.48.16.26
  • 06-88-48-16-26
Format international
  • +33 6 88 48 16 26
Opérateur téléphoniqueOrange
PaysFrance
TerritoireMétropole

2 commentaires


  • Fraud Watcher/Advisor le 16/09/2020 à 15:30

    A propos de cette adresse IP address : 185.169.4.179 qui confirme l’origine de sa provenance via un datacenter basé au Royaume-Uni :

    Pour les problèmes de piratage informatique, d’abus frauduleux, de spam ou de sécurité, veuillez signaler et transférez nous cet email en l'état grâce au bouton "transfert" de votre messagerie via cette adresse email suivante :

    meckorm3gra@infocom.uk

    Information related to 185.169.4.0 - 185.169.4.255

    Abuse contact for 185.169.4.0 - 185.169.4.255 is meckorm3gra@infocom.uk

    inetnum: 185.169.4.0 - 185.169.4.255
    netname: UK-INFOCOM-20200803
    country: GB
    org: ORG-IUL9-RIPE
    admin-c: IUH4-RIPE
    tech-c: IUH4-RIPE
    status: ALLOCATED PA
    mnt-by: INFOCOM-MNT
    mnt-by: RIPE-NCC-HM-MNT
    created: 2020-08-03T11:29:38Z
    last-modified: 2020-08-03T11:29:38Z... Lire la suite

    Répondre
  • Fraud Watcher/Advisor le 17/09/2020 à 05:27

    A propos de cette adresse IP address : 69.171.232.138 qui confirme l’origine de sa provenance via la start-up Facebook basée à Menlo Park, dans l’état de Californie (USA) :

    Pour les problèmes de piratage informatique, d’abus frauduleux, de spam ou de sécurité, veuillez signaler et transférez nous cet email en l'état grâce au bouton "transfert" de votre messagerie via ces adresses emails suivantes :

    domain@facebook.com

    abuse@facebook.com

    ou par téléphone au +1 650 543 4800

    Veuillez envoyer les rapports d'abus à abuse@facebook.com
    Please send abuse reports to abuse@facebook.com

    NetRange: 69.171.224.0 - 69.171.255.255
    CIDR: 69.171.224.0/19
    NetName: TFBNET3
    NetHandle: NET-69-171-224-0-1
    Parent: NET69 (NET-69-0-0-0-0)
    NetType: Direct Assignment... Lire la suite

    Répondre

 
 
 

Votre commentaire sera mis en ligne
immédiatement après votre validation
Francais Anglais Espagnol Italien Allemand