Logo Signal-Arnaques.com
Ensemble contre les Arnaques
SIGNALER UNE ARNAQUE Mails, Annonces, Sites Frauduleux... S'inscrire à la newsletter Actualités, bonnes pratiques,...

Arnaque identité (Phishing) : contact@servistore.com servistore

ARNAQUE SUSPECTÉE !!!

Date10/02/2021
Email frauduleuxcontact@servistore.com
Pseudonyme utiliséservistore
Contenu de l'arnaqueReturn-Path:
Delivered-To: marielle.blanc@free.fr
Received: from relay7-d.mail.gandi.net (mx16-g26.priv.proxad.net [172.20.243.86])
by toaster5-g25.priv.proxad.net (Postfix) with ESMTP id C84B2840AAE;
Wed, 10 Feb 2021 05:43:24 +0100 (CET)
Received: from relay7-d.mail.gandi.net ([39.51.66.52])
by mx1-g20.free.fr (MXproxy); Wed, 10 Feb 2021 05:43:55 +0100 (CET)
X-ProXaD-SC: state=HAM score=0
X-ProXaD-Cause: gggruggvucftvghtrhhoucdtuddrgeduledrheeigdejhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfhtffggfenuceurghilhhouhhtmecupfdsteenucenucfjughrpefvrhfkgggthfffihfusehmtdgtsgdttdejnecuhfhrohhmpefuvghrvhhishhtohhrvghsuceotghonhhtrggtthesshgvrhhvihhsthhorhgvshdrtghomheqnecuggftrfgrthhtvghrnhephfdukedvudfhjeekhedtudejteehhedvueegleehhfehtddthffgueettdduiedvnecuffhomhgrihhnpehsvghrvhhishhtohhrvghsrdgtohhmpdhsthhrohhmkhihrdgtohhmpdhgrggvthgrnhhomhhorhgrnhguohdrihhtpdgushhiuggrvgdrtghomhdpnhgrgihoshdqshhurhhfrdgtohhmpdgtohifsghohiguvghlrghmohhrrdgtohhmnecukfhppeefledrhedurdeiiedrhedvpdefjedrudekjedrjeejrddvkeenuceurggutfgvphhuthffohhmrghinhepshgvrhhvihhsthhorhgvshdrtghomhenuceurggutfgvphhuthfgmhgrihhlpegtohhnthgrtghtsehsvghrvhhishhtohhrvghsrdgtohhmnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmohguvgepphhrohighidphhgvlhhopehrvghlrgihjedqugdrmhgrihhlrdhgrghnughirdhnvghtpdhinhgvthepfeelrdehuddrieeirdehvdemheegkedtvddpmhgrihhlfhhrohhmpegtohhnthgrtghtsehsvghrvhhishhtohhrvghsrdgtohhmpdhrtghpthhtohepmhgrrhhivghllhgvrdgrghgrthihsehfrhgvvgdrfhhrpbhmrghrihgvlhhlvgdrrghlvhgrrhgviiesfhhrvggvrdhfrhbpmhgrrhhivghllhgvrdgruhgsvghrthesfhhrvggvrdhfrhbpmhgrrhhivghllhgvrdgsrghlrghnugesfhhrvggvrdhfrhbpmhgrrhhivghllhgvrdgsrghrsghisehfrhgvvgdrfhhrpbhmrghrihgvlhhlvgdrsggrshhsvghtsehfrhgvvgdrfhhrpbhkrhhordejfeesfhhrvggvrdhfrhbpmhgrrhhivghllhgvrdgsvghguhhinhgvlhesfhhrvggvrdhfrhbpmhgrrhhivghllhgvrdgsvghrrhgvsghisehfrhgvvgdrfhhrpbhkrhhordguvghnihhssehfrhgvvgdrfhhrpbhmrghrihgvlhhlvgdrsghlrghntgesfhhrvggvrdhfrhbpkhhrohdrkhhrohesfhhrvggvrdhfrhbpmhgrrhhivghllhgvrdgsohhishguohhnsehfrhgvvgdrfhhrpbhkrhhordhmihhnvghtsehfrhgvvgdrfhhrpbhkrhhotdehsehfrhgvvgdrfhhrpbhmrghrihgvlhhlvgdrsghouhhrghgvthesfhhrvggvrdhfrhbpkhhrohgrshhtrghrohhothhssehfrhgvvgdrfhhrpbhkrhhosggvrhhtshdusehfrhgvvgdrfhhrpbhmrghrihgvlhhlvgdrsgifsehfrhgvvgdr
X-ProXaD-Context: mhhouggvpehprhhogiihsbbphhgvlhhopehrvghlrgihjedqugdrmhgrihhlrdhgrghnughirdhnvghtsbbpihhnvghtpeefledrhedurdeiiedrhedvmeehgeektddvsbbpmhgrihhlfhhrohhmpegtohhnthgrtghtsehsvghrvhhishhtohhrvghsrdgtohhmsbbprhgtphhtthhopehmrghrihgvlhhlvgdrrghgrghthiesfhhrvggvrdhfrhbpmhgrrhhivghllhgvrdgrlhhvrghrvgiisehfrhgvvgdrfhhrpbhmrghrihgvlhhlvgdrrghusggvrhhtsehfrhgvvgdrfhhrpbhmrghrihgvlhhlvgdrsggrlhgrnhgusehfrhgvvgdrfhhrpbhmrghrihgvlhhlvgdrsggrrhgsihesfhhrvggvrdhfrhbpmhgrrhhivghllhgvrdgsrghsshgvthesfhhrvggvrdhfrhbpkhhrohdrjeefsehfrhgvvgdrfhhrpbhmrghrihgvlhhlvgdrsggvghhuihhnvghlsehfrhgvvgdrfhhrpbhmrghrihgvlhhlvgdrsggvrhhrvggsihesfhhrvggvrdhfrhbpkhhrohdruggvnhhishesfhhrvggvrdhfrhbpmhgrrhhivghllhgvrdgslhgrnhgtsehfrhgvvgdrfhhrpbhkrhhordhkrhhosehfrhgvvgdrfhhrpbhmrghrihgvlhhlvgdrsghoihhsughonhesfhhrvggvrdhfrhbpkhhrohdrmhhinhgvthesfhhrvggvrdhfrhbpkhhrohdtheesfhhrvggvrdhfrhbpmhgrrhhivghllhgvrdgsohhurhhgvghtsehfrhgvvgdrfhhrpbhkrhhorghsthgrrhhoohhtshesfhhrvggvrdhfrhbpkhhrohgsvghrthhsudesfhhrvggvrdhfrhbpmhgrrhhivghllhgvrdgsfiesfhhrvggvrd
To: marielle.agaty@free.fr
Reply-To: Servistores
Message-ID:
MIME-Version: 1.0
Content-Type: multipart/mixed;
boundary="----=_Part_48644_170325320.1603636438468"
From: Servistores
Date: Wed, 10 Feb 2021 04:37:56 +0000
X-Originating-IP: 37.187.77.28
Subject: Confirmation enregistrement commande sur servistores.com

------=_Part_48644_170325320.1603636438468
Content-Type: text/html; charset=UTF-8
Content-Transfer-Encoding: quoted-printable

Votre commande a bien =C3=A9t=C3=
=A9 enregistr=C3=A9e sur le site http://www.servistores.comLe num=
=C3=A9ro de r=C3=A9f=C3=A9rence Servistores:CDPT2010Z04752=
Heure de la commande:25/10/2020 15H32Total TTC:14.76=E2=82=AC 8 Voir la version PDF de la commande CDPT2010Z04752=
Veuillez noter que la commande est simplement enregistr=C3=A9e.Elle ne sera trait=C3=A9e =
par Servistores qu'apr=C3=A8s r=C3=A9ception/validation du paiement.Si vous n'effectuez pas le paiement ou si ce dernier est refus=C3=A9,=
la commande sera ignor=C3=A9e.Une fois votre paiement effectu=C3=
=A9, vous recevrez un second mail,pour vous informer de la bonne r=C3=
=A9ception de votre paiement par Servistores.Attention, pour =C3=A9vit=
er d'=C3=AAtre consid=C3=A9r=C3=A9 comme du spam,ce mail ne sera e=
nvoy=C3=A9 qu'apr=C3=A8s un d=C3=A9lai de 15 minutes,=C3=A0 compte=
r =C3=A0 partir de la r=C3=A9ception du paiement.Conform=C3=A9ment =C3=A0 l=
a l=C3=A9gislation en vigueur (D=C3=A9cret n=C2=B02014-1061 du 17/09/2014 J=
O du 19) sur la vente =C3=A0 en ligne,nous vous rappelons que vous ave=
z 14 jours pour exercer votre droit de r=C3=A9tractation.Pour plus de =
pr=C3=A9cisions vous pouvez lire nos condition=
s g=C3=A9n=C3=A9rales de vente.Pour demander l'annulation de v=
otre commande par mail veuillez nous contacter =C3=A0 l'aide du formula=
ire suivant:Demande annulation de commande par=
mailPour demande l'annulation de votre commande par courrier =
vous pouvez utiliser le mod=C3=A8le suivant:De=
mande annulation de commande par courrierPour revoir le=
d=C3=A9tail de cette commande,Vous pouvez vous connecter sur votre co=
mpte en ligne.Pour cela cliquer sur le lien:Mes commandesVotre commande ne sera trait=C3=A9e qu'=
;apr=C3=A8s r=C3=A9ception/validation du paiement. 7 8 SERVISTORES 6
------=_Part_48644_170325320.1603636438468--
Commentaire / ExplicationsConfirmation enregistrement commande sur servistores.com
De Servistores
À marielle.agaty@free.fr
Date Aujourd'hui 05:37
Photo du contact
Corps du courriel

Votre commande a bien été enregistrée sur le site http://www.servistores.com

Le numéro de référence Servistores:CDPT2010Z04752

Heure de la commande:25/10/2020 15H32
Total TTC:14.76€

8 Voir la version PDF de la commande CDPT2010Z04752

Veuillez noter que la commande est simplement enregistrée.
Elle ne sera traitée par Servistores qu'après réception/validation du paiement.
Si vous n'effectuez pas le paiement ou si ce dernier est refusé, la commande sera ignorée.

Une fois votre paiement effectué, vous recevrez un second mail,
pour vous informer de la bonne réception de votre paiement par Servistores.
Attention, pour éviter d'être considéré comme du spam,
ce mail ne sera envoyé qu'après un délai de 15 minutes,
à compter à partir de la réception du paiement.
Conformément à la législation en vigueur (Décret n°2014-1061 du 17/09/2014 JO du 19) sur la vente à en ligne,
nous vous rappelons que vous avez 14 jours pour exercer votre droit de rétractation.
Pour plus de précisions vous pouvez lire nos conditions générales de vente.
Pour demander l'annulation de votre commande par mail veuillez nous contacter à l'aide du formulaire suivant:Demande annulation de commande par mail
Pour demande l'annulation de votre commande par courrier vous pouvez utiliser le modèle suivant:Demande annulation de commande par courrier

Pour revoir le détail de cette commande,
Vous pouvez vous connecter sur votre compte en ligne.
Pour cela cliquer sur le lien:Mes commandes

Votre commande ne sera traitée qu'après réception/validation du paiement.
7 8 SERVISTORES
6
Pour en Savoir +
Alertez vos Amis !

  • Les avis et commentaires laissés par les internautes sont classés par ordre chronologique et ne sont pas contrôlés à priori.

    • Danièle le 26/02/2021 à 11:24

      J'ai reçu exactement le même document avec la même somme à régler. Je pense qu'il s'agit d'une arnaque.

      Répondre
    • Fraud Watcher/Advisor le 15/01/2022 à 01:27

      À propos de cette adresse IP address : 37.187.77.28 qui confirme l’origine de sa provenance via un datacenter (centre de données) d’un fournisseur d’hébergement de sites web basé à Roubaix en France :

      Pour les problèmes de piratage informatique, d’abus frauduleux, de spam ou de sécurité, veuillez signaler et transférez nous cet email suspect en l'état grâce au bouton "transfert" de votre messagerie via ces adresses emails officielles :

      abuse@ovh.net

      fraude@ovh.com

      ou par téléphone au 09 72 10 10 07 et par fax : 03 20 20 09 58

      registry.default.admin@domain.ovh.net
      ou par téléphone au 09 74 53 08 14

      Veuillez noter que les informations que vous nous communiquerez pourront être partagées à des tiers afin de nous permettre de lutter contre ces menaces.... Lire la suite

      Répondre

    Votre commentaire sera mis en ligne
    immédiatement après votre validation

  • Groupe créé le - 0 Membres

    Pour visualiser le contenu de ce groupe privé ou demander à le rejoindre, vous devez créer un compte ou vous connecter .