Logo Signal-Arnaques.com
Ensemble contre les Arnaques
SIGNALER UNE ARNAQUE Mails, Annonces, Sites Frauduleux... S'inscrire à la newsletter Actualités, bonnes pratiques,...

Autre arnaque : SAV

ARNAQUE SUSPECTÉE !!!

Date20/01/2022
Pseudonyme utiliséSAV
Contenu de l'arnaqueNETFLIX
veuillez mettre à jour vos informations

(Là il y a un bouton sur lequel cliquer intitulé MISE A JOUR DE VOS INFORMATIONS)

Malheureusement, nous n'avons pas pu autoriser le renouvellement de votre prochain cycle d'abonnement. Votre accès au service sera limité prochainement.

Pour restaurer votre compte, veuillez mettre à jour vos informations.

MISE A JOUR DE VOS INFORMATIONS
archive81pkss
“ Auteure de polars, Grace Miller a l'instinct aiguisé et s'y connaît en mobiles. Son expertise l'aidera-t-elle à percer le mystère du meurtre de sa sœur ? ”

Vos séries et films sans limites

“ Dans ce drame inspiré de faits réels, un adolescent de Détroit devient indic pour le FBI puis dealer de drogue, au plus fort de "l'épidémie du crack" des années 1980. ”

afterlifepkss
Commentaire / Explications2 messages d'arnaque : Nous n'avons jamais souscrit NETFLIX

2è message :
Subject : [FR] interruption de votre abonnement.

Date : Thu, 20 Jan 2022 01:20:33 GMT

From : S.A.V

To : lise.traverse@wanadoo.fr

Content-Type : text/html

Feedback-ID : 1.us-east-1.ngnu+KP2kbQ10bylSsGeIZKxJJra8No3rUbX5ZEgCzE=:AmazonSES

MIME-Version : 1.0

Message-ID : <0100017e75122e7f-01095774-7c19-4196-8468-9616ae6ee78f-000000@email.amazonses.com>

Received : from opme11d1d01nd1.rouen.francetelecom.fr ([10.217.70.40]) by opme11d1b42nd1.rouen.francetelecom.fr with LMTP id iH2HLOG46GEbRwAA3+P50g (envelope-from <0100017e75122e7f-01095774-7c19-4196-8468-9616ae6ee78f-000000@amazonses.com>); Thu, 20 Jan 2022 02:20:33 +0100,from opme11ppr37nd1.nor.fr.intraorange ([10.217.70.40]) by opme11d1d01nd1.rouen.francetelecom.fr with LMTP id qHGWLOG46GH6ZgAAdG9hYA (envelope-from <0100017e75122e7f-01095774-7c19-4196-8468-9616ae6ee78f-000000@amazonses.com>) for ; Thu, 20 Jan 2022 02:20:33 +0100,from opmta1mti13nd1 ([10.79.5.104]) by opme11ppr37nd1.nor.fr.intraorange with LMTP id gC5ILOG46GFXfQAAhTFaUQ (envelope-from <0100017e75122e7f-01095774-7c19-4196-8468-9616ae6ee78f-000000@amazonses.com>) for ; Thu, 20 Jan 2022 02:20:33 +0100,from a48-101.smtp-out.amazonses.com ([54.240.48.101]) by smtp.orange.fr with ESMTP id AM5znjZ0f8a3VAM7tn7xCM; Thu, 20 Jan 2022 02:20:33 +0100

X-ME-Entity : ofr

DKIM-Signature : v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple; s=ug7nbtf4gccmlpwj322ax3p6ow6yfsug; d=amazonses.com; t=1642641633; h=MIME-Version:From:To:Date:Subject:Content-Type:Content-Transfer-Encoding:Message-ID:Feedback-ID; bh=zzh6ggXgMlRKGnEIooHOO5QLhifCihmFsEmireQUXJU=; b=VM6uDDHqt/HYCEKW3/B0HWk7erjaN1XdHuWxQnNJAYFS3FI/69IEnIAP/ARytqOw bKkpvzUCJLKepBAMZzv6mqdAj9Qr2grOU005rUOPq2SlcSConySU4k8nv3oU4XKF9es 9IPb2UXhG3M+WOIPRZe+iNqEXEVHxKc9AhHBmAI0=,v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple; s=nxa4nujowif6y3r5fpzwnqvahf4ekmqc; d=alfacart.com; t=1642641633; h=MIME-Version:From:To:Date:Subject:Content-Type:Content-Transfer-Encoding:Message-ID; bh=zzh6ggXgMlRKGnEIooHOO5QLhifCihmFsEmireQUXJU=; b=pP8c/Si7Hcs00sc9DUL/i50GvRojhEJBdj4aEibkyGuI7vl3oLR8BS6EZCUCa0vS /QKFBfNqoYNXOPQvE3kKJKkml4r1pu/MwbmK1O6qkGSwgHi9Smr9JtFpqRxQoqLjwvP 10CwzG/mAjaaUCoLsWWgEn8dcRhXN/k9gFXuFC80=

X-me-spamlevel : not-spam

X-ME-bounce-domain : wanadoo.fr

X-ME-engine : default

X-bcc : lise.traverse@wanadoo.fr

X-ME-IP : 54.240.48.101

X-ME-Helo : a48-101.smtp-out.amazonses.com

Content-Transfer-Encoding : base64

X-me-spamcause : (1)(0000)gggruggvucftvghtrhhoucdtuddrgedvvddrudejgdeffecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecuhedttdenucgofgevgfdqoffgqddqtehmrgiiohhnufgvshdqshhtuhguhiculddumdenucfjughrpegghffvfffutgfgkfeshhgsredttddtjeenucfhrhhomhepfdfurdetrdggfdcuoehinhhfohesrghlfhgrtggrrhhtrdgtohhmqeenucggtffrrghtthgvrhhnpeegueeftdefvedttdeviedvheehieeiteekkeevheethefhfedtvddufeffuedutdenucffohhmrghinhepnhgvthdqvhgvrhhifhhitggrthhiohhnrdhnvghtnecukfhppeehgedrvdegtddrgeekrddutddunecuvehluhhsthgvrhfuihiivgepgedunecurfgrrhgrmhephhgvlhhopegrgeekqddutddurdhsmhhtphdqohhuthdrrghmrgiiohhnshgvshdrtghomhdpihhnvghtpeehgedrvdegtddrgeekrddutddupdhmrghilhhfrhhomheptddutddttddujegvjeehuddvvdgvjehfqddtuddtleehjeejgedqjegtudelqdegudeliedqkeegieekqdelieduiegrvgeivggvjeekfhdqtddttddttddtsegrmhgriihonhhsvghsrdgtohhmpdhrtghpthhtoheplhhishgvrdhtrhgrvhgvrhhsvgesfigrnhgrughoohdrfhhrpdhnsggprhgtphhtthhopedu

X-SES-Outgoing : 2022.01.20-54.240.48.101

Return-Path : <0100017e75122e7f-01095774-7c19-4196-8468-9616ae6ee78f-000000@amazonses.com>

1er message
Subject : Notification de suspension.

Date : Wed, 19 Jan 2022 02:03:46 GMT

From : S.A.V

To : lise.traverse@wanadoo.fr

Content-Type : multipart/related

Feedback-ID : 1.us-east-1.ngnu+KP2kbQ10bylSsGeIZKxJJra8No3rUbX5ZEgCzE=:AmazonSES

Message-ID : <0100017e70136128-342765d5-e923-4515-be85-28253564dee9-000000@email.amazonses.com>

MIME-Version : 1.0

Received : from opme11d1d06nd1.rouen.francetelecom.fr ([10.217.70.41]) by opme11d1b42nd1.rouen.francetelecom.fr with LMTP id 4DjmCoJx52HhSgAA3+P50g (envelope-from <0100017e70136128-342765d5-e923-4515-be85-28253564dee9-000000@amazonses.com>); Wed, 19 Jan 2022 03:03:46 +0100,from opme11ppr38nd1.nor.fr.intraorange ([10.217.70.41]) by opme11d1d06nd1.rouen.francetelecom.fr with LMTP id UObNCoJx52EcGwAAPxMDWA (envelope-from <0100017e70136128-342765d5-e923-4515-be85-28253564dee9-000000@amazonses.com>) for ; Wed, 19 Jan 2022 03:03:46 +0100,from opmta1mti50nd1 ([10.79.5.102]) by opme11ppr38nd1.nor.fr.intraorange with LMTP id 6PKrCoJx52GWfgAA13efiQ (envelope-from <0100017e70136128-342765d5-e923-4515-be85-28253564dee9-000000@amazonses.com>) for ; Wed, 19 Jan 2022 03:03:46 +0100,from a48-105.smtp-out.amazonses.com ([54.240.48.105]) by smtp.orange.fr with ESMTP id A0JdnFZvoCqvsA0K9nFxFF; Wed, 19 Jan 2022 03:03:46 +0100

X-ME-Entity : ofr

DKIM-Signature : v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple; s=ug7nbtf4gccmlpwj322ax3p6ow6yfsug; d=amazonses.com; t=1642557825; h=From:To:Subject:Date:Message-ID:MIME-Version:Content-Type:Feedback-ID; bh=hWTCdW1pa+PjOSJk/3pFvi2I6fdmOtzILYoy2tMpA1w=; b=AyUDjufRYtmnglJlGyn6cIN2tv4UgmVWidsrmdfNU+xEPVNmTR/OMiqqZg650ZMW Ai2/6Rsqz/skO7JA0g1yMhXuQ5NVEIJp9AHhJa5y3+CQoWUo0mgRyAk4VOq8XoFXVkJ hEYrkJT1U1+36O52DIONRC0MCP+jguEjsEXBM5/8=,v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple; s=nxa4nujowif6y3r5fpzwnqvahf4ekmqc; d=alfacart.com; t=1642557825; h=From:To:Subject:Date:Message-ID:MIME-Version:Content-Type; bh=hWTCdW1pa+PjOSJk/3pFvi2I6fdmOtzILYoy2tMpA1w=; b=uLCXMdfW4A5pz3p62c3BdskMNJwjj8oiSsn0bAFEgbFKwJif27risMSDYMg/+tdq 2Zfms8WfBwWXX7f7ExbGS7V8t6lzLjLJm+TV5GmKwyGAES7MHBO21UWNLovZceJUnx1 RHkRUVflZWdrjJ00Umgdk50UtjkIqEvgUKtc1Gd8=

X-me-spamlevel : not-spam

X-ME-bounce-domain : wanadoo.fr

X-ME-engine : default

X-bcc : lise.traverse@wanadoo.fr

X-Mailer : Microsoft CDO for Windows 2000

Priority : normal

X-MimeOLE : Produced By Microsoft MimeOLE

thread-index : AdgM2MmpI6p9KCs2SE+r6juLfvGyJg==

X-ME-IP : 54.240.48.105

X-ME-Helo : a48-105.smtp-out.amazonses.com

Content-Class : urn:content-classes:message

X-me-spamcause : (1)(0000)gggruggvucftvghtrhhoucdtuddrgedvvddrudeggdegtdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecuhedttdenucgofgevgfdqoffgqddqtehmrgiiohhnufgvshdqshhtuhguhiculddumdenucfjughrpehthffvufffkfggtgfonfgkqfesrhdtreepfedtjeenucfhrhhomhepufdrtedrggcuoehhrghrihhsrdhrrghfihhqsegrlhhfrggtrghrthdrtghomheqnecuggftrfgrthhtvghrnhepfeellefgleegfeetheelvdeukeekffekgfffhfdthffghfegfeekteefleefgefgnecuffhomhgrihhnpehnvghtfhhlrghgvggurhdrtghomhenucfkphepheegrddvgedtrdegkedruddtheenucevlhhushhtvghrufhiiigvpeduudenucfrrghrrghmpehhvghloheprgegkedquddthedrshhmthhpqdhouhhtrdgrmhgriihonhhsvghsrdgtohhmpdhinhgvthepheegrddvgedtrdegkedruddthedpmhgrihhlfhhrohhmpedtuddttddtudejvgejtddufeeiuddvkedqfeegvdejieehugehqdgvledvfedqgeehudehqdgsvgekhedqvdekvdehfeehieeguggvvgelqddttddttddttdesrghmrgiiohhnshgvshdrtghomhdprhgtphhtthhopehlihhsvgdrthhrrghvvghrshgvseifrghnrgguohhordhfrhdpnhgspghrtghpthhtohepud

X-SES-Outgoing : 2022.01.19-54.240.48.105

Thread-Topic : Notification de suspension.

Return-Path : <0100017e70136128-342765d5-e923-4515-be85-28253564dee9-000000@amazonses.com>

Pour en Savoir +
Thématique(s) liée(s)
Alertez vos Amis !

    Votre commentaire sera mis en ligne
    immédiatement après votre validation

  • Groupe créé le - 0 Membres

    Pour visualiser le contenu de ce groupe privé ou demander à le rejoindre, vous devez créer un compte ou vous connecter .