Logo Signal-Arnaques.com
Ensemble contre les Arnaques
SIGNALER UNE ARNAQUE Mails, Annonces, Sites Frauduleux... S'inscrire à la newsletter Actualités, bonnes pratiques,...

Autre arnaque : robert.antzlinger@orange.fr

ARNAQUE SUSPECTÉE !!!

Date04/06/2022
Pseudonyme utilisérobert.antzlinger@orange.fr
Contenu de l'arnaqueVous avez été sélectionné(e) pour participer GRATUITEMENT à notre Programme de Fidélité LIDL !

Cela ne vous prendra qu'une minute pour gagner votre machine. .
Commander
Commentaire / ExplicationsLes propriétés du message
L'arnaqueur a utilisé mon adresse pour m’envoyer le message
D'après l'IP il vient Russie.

X-Me-Spamwebmail: HAM
Return-Path:
Received: from opme11d1d06aub.bagnolet.francetelecom.fr ([10.79.3.107])
by opme11d1b10aub.bagnolet.francetelecom.fr with LMTP
id cAWpDkg1mmJgIQAAFHDnNg
(envelope-from ); Fri, 03 Jun 2022 18:22:32 +0200
Received: from opme11ppr28aub.idf.fr.intraorange ([10.79.3.107])
by opme11d1d06aub.bagnolet.francetelecom.fr with LMTP
id YAmNDkg1mmJwGwAAr33M9g
(envelope-from )
for ; Fri, 03 Jun 2022 18:22:32 +0200
Received: from opmta1mti88nd1 ([10.79.3.107])
by opme11ppr28aub.idf.fr.intraorange with LMTP
id uIBIEEg1mmIfGwAAEk4PFA
(envelope-from )
for ; Fri, 03 Jun 2022 18:22:32 +0200
Received: from dreamcafe.orange.fr ([185.233.0.94])
by smtp.orange.fr with ESMTP
id xA4Fno5FMX5YvxA4FnWaGJ; Fri, 03 Jun 2022 18:22:32 +0200
X-bcc: robert.antzlinger@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (15)(0000)gggruggvucftvghtrhhoucdtuddrgedvfedrleeigdelkecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfogfdpggftiffpkfenuceurghilhhouhhtmecuhedttdenucgoteeftdduqddtudculdduhedmnecujfgurhepfffhvffugggtgfeshhhqtddttddtjeenucfhrhhomheprhhosggvrhhtrdgrnhhtiihlihhnghgvrhesohhrrghnghgvrdhfrheorhhosggvrhhtrdgrnhhtiihlihhnghgvrhesohhrrghnghgvrdhfrheqnecuggftrfgrthhtvghrnhepuefgvefhfffhhefhudffgfffuefhheduteevfefgkeeiudevtedugeetudetuddvnecuffhomhgrihhnpeifvggsshhtrghrshhtuhguihhordgtohhmnecukfhppedukeehrddvfeefrddtrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopegurhgvrghmtggrfhgvrdhorhgrnhhgvgdrfhhrpdhinhgvthepudekhedrvdeffedrtddrleegpdhmrghilhhfrhhomhepnhhorhgvphhlhieshhhumhgslhgvsghunhgulhgvrdgtohhmpdhrtghpthhtoheprhhosggvrhhtrdgrnhhtiihlihhnghgvrhesohhrrghnghgvrdhfrhdpnhgspghrtghpthhtohepud
X-me-spamlevel: not-spam
X-ME-Helo: dreamcafe.orange.fr
X-ME-IP: 185.233.0.94
X-ME-Entity: ofr
Message-ID: <75a63cf1ca7c22fb4ad8770a97ebaa3c@opmta1mti88nd1.creteil.francetelecom.fr>
Date: Fri, 03 Jun 2022 18:20:09 +0200
From:robert.antzlinger@orange.fr
To:
Subject:J'en Profite
MIME-Version: 1.0
Content-Type: text/html; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Pièce(s) jointe(s)
Pour en Savoir +
Thématique(s) liée(s)
Alertez vos Amis !
Victime d'une arnaque ? Faites-vous aider

  • Les avis et commentaires laissés par les internautes sont classés par ordre chronologique et ne sont pas contrôlés à priori. En savoir +

    • Oliv4 le 30/06/2022 à 00:50

      Idem. Je viens de recevoir un mail de la part de mon adresse, avec une pub pour Darty.
      L'adresse IP est 185.233.0.94
      Que faire pour bloquer cet expéditeur ?:
      Subject : J'en Profite

      Date : Thu, 30 Jun 2022 00:06:37 GMT

      From : oliv04300@orange.fr

      To : oliv04300@orange.fr

      Content-Type : text/html

      Message-ID : <2aa71f0f189fa4de92d84b77c541e5b0@opmta1mti05nd1.creteil.francetelecom.fr>

      MIME-Version : 1.0

      Received : from opme11d2d01nd1.nor.fr.intraorange ([10.79.5.103]) by opme11d2b04nd1.nor.fr.intraorange with LMTP id kJSJFQ3pvGKRVAAAxKtQIg (envelope-from ); Thu, 30 Jun 2022 02:06:37 +0200,from opme11ppr01nd1.nor.fr.intraorange ([10.79.5.103]) by opme11d2d01nd1.nor.fr.intraorange with LMTP id 6HZUFQ3pvGJLDgAA8dRvHA (envelope-from ) for ; Thu, 30 Jun 2022 02:06:37 +0200,from opmta1mti05nd1 ([10.79.5.103]) by opme11ppr01nd1.nor.fr.intraorange with LMTP id GO4qFQ3pvGI0GwAATZED1w (envelope-from ) for ; Thu, 30 Jun 2022 02:06:37 +0200,from actu.orange.fr ([185.233.0.94]) by smtp.orange.fr with ESMTP id 6hhcoi6VdCLpy6hhdojQsp; Thu, 30 Jun 2022... Lire la suite

      Répondre
    • Oliv4 le 30/06/2022 à 00:53

      la dernière ligne de l'entête complet complet est :
      Return-Path :

      Répondre
    • Fraud Watcher/Advisor le 04/08/2022 à 18:02

      À propos de ces fausses adresses emails déclarées frauduleuses comme SPAM parmi tant d’autres et estampillées à leur insu soi disant au nom de Créteil France Telecom :

      154e72a4d08f6a0631c41871a850ce04@opmta1mti48nd1.creteil.francetelecom.fr
      2aa71f0f189fa4de92d84b77c541e5b0@opmta1mti05nd1.creteil.francetelecom.fr
      505973d72d60c685f915181ddf8d7c53@opmta1mti70nd1.creteil.francetelecom.fr
      51fcea9754b120fec9d83d0757d1101a@opmta1mti05nd1.creteil.francetelecom.fr
      586a328a610e7c183a28ed92b6738ede@opmta1mti72nd1.creteil.francetelecom.fr
      75a63cf1ca7c22fb4ad8770a97ebaa3c@opmta1mti88nd1.creteil.francetelecom.fr
      …/…

      associées à ce site web inaccessible et non sécurisé http://opmta1mti48nd1.creteil.francetelecom.fr servant à l’escroc de créer une (ou plusieurs) adresse(s) de messagerie web d’un serveur détourné illégalement à leur insu et (r)attachée(s) à l’enregistrement d’un nom de domaine internet spolié et hébergé auprès d’un serveur/fournisseur d’hébergement de sites web.... Lire la suite

      Répondre
    • Oliv4 le 04/08/2022 à 18:27

      Ok, merci.

      Répondre
    • Fraud Watcher/Advisor le 04/08/2022 à 18:40

      À propos de cette adresse IP address: 185.233.0.94 qui confirme l’origine de sa provenance via un datacenter (centre de données) d’un des premiers fournisseurs de services de location d'infrastructure virtuelle basé à Saint-Petersburg, en Russie.

      Pour signaler les problèmes de piratage informatique, d’abus frauduleux, de spam ou de sécurité, veuillez signaler et transférez nous cet email en l'état grâce au bouton "transfert" de votre messagerie via ces adresses emails suivantes :

      noc@1cloud.ru

      abuse@it-grad.ru

      Information related to 185.233.0.0 - 185.233.0.255

      Abuse contact for 185.233.0.0 - 185.233.0.255 is noc@1cloud.ru

      inetnum: 185.233.0.0 - 185.233.0.255
      netname: OneCloud-SPB
      country: RU(SSIE) | RU(SSIA)
      admin-c: ITG6-RIPE
      tech-c: ITG6-RIPE... Lire la suite

      Répondre

    Votre commentaire sera mis en ligne
    immédiatement après votre validation

  • Groupe créé le - 0 Membres

    Pour visualiser le contenu de ce groupe privé ou demander à le rejoindre, vous devez créer un compte ou vous connecter .