Logo Signal-Arnaques.com
Ensemble contre les Arnaques
SIGNALER UNE ARNAQUE Mails, Annonces, Sites Frauduleux... S'inscrire à la newsletter Actualités, bonnes pratiques,...

Arnaque de loterie : une llsurprisell a vous

ARNAQUE SUSPECTÉE !!!

Date27/06/2022
Pseudonyme utiliséune llsurprisell a vous
Contenu de l'arnaqueVoir image jpeg en fichier joint
Commentaire / ExplicationsReturn-Path:
Received: from opme11d1d08nd1.rouen.francetelecom.fr ([10.217.70.16])
by opme11d1b33nd1.rouen.francetelecom.fr with LMTP
id 0KOAEAc/uWLsMwAA9t6+Eg
(envelope-from ); Mon, 27 Jun 2022 07:24:23 +0200
Received: from opme11ppr13nd1.nor.fr.intraorange ([10.217.70.16])
by opme11d1d08nd1.rouen.francetelecom.fr with LMTP
id uE9lEAc/uWJNGwAAmzDmYg
(envelope-from )
for ; Mon, 27 Jun 2022 07:24:23 +0200
Received: from opmta1mti35nd1 ([10.79.5.103])
by opme11ppr13nd1.nor.fr.intraorange with LMTP
id OONCEAc/uWIWGwAAIw2kPg
(envelope-from )
for ; Mon, 27 Jun 2022 07:24:23 +0200
Received: from label2020.gr ([103.79.16.7])
by smtp.orange.fr with ESMTP
id 5hEQo1plbskzJ5hEQotoh1; Mon, 27 Jun 2022 07:24:23 +0200
X-bcc: antzbob@orange.fr
X-ME-bounce-domain: orange.fr
X-ME-engine: default
X-me-spamcause: (0)(0000)gggruggvucftvghtrhhoucdtuddrgedvfedrudeggedgleduucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuoffgpdggtffipffknecuuegrihhlohhuthemucehtddtnecunecujfgurhephffvkffugggtffesrhdtregstddtjeenucfhrhhomhepfdhmshhlihgulhdrnhhothhifhhitggrthhiohhnfdcuoegrnhhnohhunhgtvgesrghmrgiiohhnrdhfrheqnecuggftrfgrthhtvghrnheptdelhfdvledvgfeljeduteefhfejueehiedutdejfffhieehheffkeetgeejgfeunecukfhppedutdefrdejledrudeirdejpdehgedrvdegtddrtddruddtgeenucevlhhushhtvghrufhiiigvpeeinecurfgrrhgrmhephhgvlhhopehlrggsvghlvddtvddtrdhgrhdpihhnvghtpedutdefrdejledrudeirdejpdhmrghilhhfrhhomhepsghouhhntggvsehtrghgghgvughmrghilhdrtghomhdprhgtphhtthhopegrnhhtiigsohgssehorhgrnhhgvgdrfhhrpdhnsggprhgtphhtthhopedu
X-me-spamlevel: not-spam
X-ME-Helo: label2020.gr
X-ME-IP: 103.79.16.7
X-ME-Entity: ofr
Return-Path:
Received: from mailfep007.skynet.be ([10.35.4.216])
by mailafep003-svc.mx.internal
(InterMail vM.9.07.03.015 201-2473-138-3) with ESMTP
id <99941801879776.OBAE3891.mailafep003-svc.mx.internal@mailfep007.skynet.be>
for ; Mon, 27 Jun 2022 01:24:17 -0400 (EDT)
Received: from el9758.bc ([10.27.1.13]) by mailfep007.skynet.be
(InterMail vM.8.04.03.28.4 201-2389-100-182-103-20180124)
with ESMTP
id <99941801879776.MFDZ7198.mailfep007.skynet.be@el9758.bc>
for ; Mon, 27 Jun 2022 01:24:17 -0400 (EDT)
Received: from [40.92.91.28] ([40.92.91.28])
by el9758.bc with ngmta
id h6efb313-gpzg4pdnfy5yzyiq; Mon, 27 Jun 2022 01:24:17 -0400 (EDT)
Received-SPF: PermError (mx101.skynet.be: cannot correctly
interpret sender authenticity information from domain of
announce@amazon.fr) identity=pra; client-ip=54.240.0.104;
receiver=mx101.skynet.be;
envelope-from="sng9ulbd0wsgi9zke96fge5nunan0xx5rq213ky0aq8ui5-8YG4F9ATFGACTO@bounces.amazon.fr";
x-sender="announce@amazon.fr"; x-conformance=sidf_compatible;
x-record-type="spf2.0"; x-record-text="spf2.0/pra
include:amazon.com -all"
Received-SPF: Pass (mx101.skynet.be: domain of
sng9ulbd0wsgi9zke96fge5nunan0xx5rq213ky0aq8ui5-8YG4F9ATFGACTO@bounces.amazon.fr
designates 54.240.0.104 as permitted sender)
identity=mailfrom; client-ip=54.240.0.104;
receiver=mx101.skynet.be;
envelope-from="sng9ulbd0wsgi9zke96fge5nunan0xx5rq213ky0aq8ui5-8YG4F9ATFGACTO@bounces.amazon.fr";
x-sender="sng9ulbd0wsgi9zke96fge5nunan0xx5rq213ky0aq8ui5-8YG4F9ATFGACTO@bounces.amazon.fr";
x-conformance=sidf_compatible; x-record-type="v=spf1";
x-record-text="v=spf1 ip4:199.255.192.0/22
ip4:199.127.232.0/22 ip4:54.240.0.0/18 ip4:69.169.224.0/20
ip4:23.249.208.0/20 ip4:23.251.224.0/19 ip4:76.223.176.0/20
ip4:54.240.64.0/19 ip4:54.240.96.0/19 ip4:52.82.172.0/22
-all"
Received-SPF: None (mx101.skynet.be: no sender authenticity
information available from domain of
postmaster@a0-104.smtp-out.eu-west-1.amazonses.com)
identity=helo; client-ip=54.240.0.104;
receiver=mx101.skynet.be;
envelope-from="sng9ulbd0wsgi9zke96fge5nunan0xx5rq213ky0aq8ui5-8YG4F9ATFGACTO@bounces.amazon.fr";
x-sender="postmaster@a0-104.smtp-out.eu-west-1.amazonses.com";
x-conformance=sidf_compatible
Authentication-Results: mx101.skynet.be; spf=PermError smtp.pra=announce@amazon.fr; spf=Pass smtp.mailfrom=sng9ulbd0wsgi9zke96fge5nunan0xx5rq213ky0aq8ui5-8YG4F9ATFGACTO@bounces.amazon.fr; spf=None smtp.helo=postmaster@a0-104.smtp-out.eu-west-1.amazonses.com; dkim=pass (signature verified) header.i=@amazon.fr; dmarc=pass (p=quarantine dis=none) d=amazon.fr
IronPort-SDR: sj+XXIrbLalo+USKlInMww8Abjp1OCsyD00HBXZ50ZVz3xwHVZh+IAcwS2jq8jYE85W9SvI/sg
06DbyvCIWHgf6EwQERgG7o6l8uIXK+USKlInMww8Abjp1OCsyD00HBXZ50ZVz3xwHVZh/AABWv
uMQ3iVXLVXQqABQba68tWBOme07ZBFRp3dEIVy5JCRC014l5eh3DjGxwR9lykKs9dlHFBLFqAS
ZTnPg21Fyc3AySSlu6fFseV/Pseno1CogyImXlKrPGID9EaICWVD5bdLNauNfsRGNnWBqbFIS8
V/XXIrbLalo/y07CMulso8/A
X-Proximus-RemoteIp: 54.240.0.104
X-Proximus-Mfrom: sng9ulbd0wsgi9zke96fge5nunan0xx5rq213ky0aq8ui5-8YG4F9ATFGACTO@bounces.amazon.fr
X-Proximus-Rcpto: antzbob@orange.fr
X-IPAS-Result: =?us-ascii?q?A0ECAzgjrLlhh2gA8DZagmKBIQGBBRplgQIECzEDF4Jhg?=
=?us-ascii?q?Q8+kROBFZs5gUAWHQQQAQECAQEBAQEzAQkNBAEBAQIBA4Q6RVMJE4I+Ah0HA?=
=?us-ascii?q?QYuCQ4BAgECAQEBAQEDAgMBAQEBAQEDAQEBBAEBAQIBAQIDAgIBAQIQAQEBA?=
=?us-ascii?q?Q0LCQUIDAUeBTxkgQgBgU4BgTAjCwMxDQkOEIIGCQQCAwIkCzAzPQ0GNgIBA?=
=?us-ascii?q?QEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBAQEBDQJENAYYAQ8BMQMBEwoTAQEHM?=
=?us-ascii?q?Rg6AQkCcoI7PQGDGgw3lAaOJII2ijcBAXmBMR9igggBAQYEAwICgTMBhiEJg?=
=?us-ascii?q?SMXhgyBHgGHB0NAgU00gRQDhQUxASMYBhEMAQEBAQQUgUkNHQGCaheCTpJMg?=
=?us-ascii?q?RN5AQENSwSBW4dghxqLLn+kOgcDJ4FSgUiBNodDgW2Ue4U5mSWIeJYvjH2Pe?=
=?us-ascii?q?YsOASWBZBsBDgd0EYFggUQJCjsBAgECDQIBAgMBAgEBAQkBAQEBjikWg1CBP?=
=?us-ascii?q?ohwMEQwAgEBAQYtAgYBCgEBAwmOXSeBbAEB?=
IronPort-PHdr: A9a23:An1rXxJwNgn72nTCN9mcuEV0WUAX0o4c3iYr45Yqw4hDbr6kt8y7e
hCFvLM81RSUA83y0LFts6LuqafuWGgNs96qkUspV9hybSIDktgchAc6AcSIWgXRJf/uaDEmT
owZDAc2t360PlJIF8ngelbcvmO97SIIGhX4KAF5Ovn5FpTdgsipyuy+4ZnebxhHiDe9YL55M
Qm7oxjWusQKm4VpN7w/ygHOontGeuRWwX1nKFeOlBvi5cm+4YBu/T1It/0u68BPX6P6f78lT
bNDFzQpL3o15MzwuhbdSwaE+2YRXX8XkhpMBAjF8Q36U5LsuSb0quZxxC+XNtDwQb4zRTms7
KFlRhzwhikGKjU19Hzbh851gK9dvRmvpQFww5TMbY+VKvRwfb7TctwGSmRPRcteTTBND5mnY
IcTE+YMP+BVpJT9qVsUqhu+ABGhCO3zxz9NnHD33Ko60+I7HQHIxgwsEc8FvXPOo9XzMqcSV
v21zK/UwjrddP5ZwzL955LJcxAmp/GAR7xwcdDIxEQpCgjKgUmep5b/MDOJyuQCrXKb7+x4W
O6zl2IqpA9/rzixyssyhYTEhZwZx1DY+Chl3os4Od21RVJ0b9OnEJVcqT2XOoprT84hTW9lp
iU3xqAJt5OlfSUHzoksyRDYa/yCaYeI4xTjWf6LLjd9nn1kebW/hxCo/Uiu0O3wTtO7301Nr
ipYjtnDrHUN2AbS68iATPtx5Emh2SyX2wDd8O5LPV47mrHcK54mwb48jIYcsUPGHiLwhU74j
7eWe10k9+Wn8ejrfLrrqoOGO4NokA3yL7gil8O5DO8lKAYBRXKb9v651LD7/U32XrFKjvoun
6bDrJzWPNkXqrK2DgNPyYYj7gq/Dy+/3NQfgHkHMEhJdwyaj4TwNVDBPuv4Deumj1ixijtk3
fXGMafgA5XKKHjDi6nufa1n50FAzwozyMhT55NSCr4fPPL+Qk/8udPCAhMnPAG43/zrBMln2
o8DRW6CDbeVMKbIvl+J4uIvLfOMZIgQuDvlNfQp++DigWIklVMDYKWk3YcbZXO4E/h4LEiUY
3nhjcwBHGoIowUyUPHmhEOcXTFOfHm/UK0x6zI/BY+kDorMXYGgjb6d0yinAJFbZG9LBU6QH
nv0b4WIR+kDaD+LLsJ/jDAKULesRpE82B6sqAL0y7toIeTV9SEGtp3uz8N65+rOlRE06TN7E
d+d33uXQGFxhGwJRjg23KZlrUxz0FePybJ4jOBAFdxP+/NJVR83NZrGwOx/EN/9RBjBfsuQR
Fa+WdimGjIxT9I3w9AQf0ZxAc6tgQ6QlxesGKIfwryXGIQvoOWbwGfuYc94wmTB0u8vlR4pW
oxBc226g6oo3F2JKKKRznS2yJiHS5Y1kg2Y1EnT8VG/gHt8YD9MH4CQQGoZNFHKq4b8/UyQF
ef0UO19a1YZmZPYdvQaYIC2gQ0fHq3vMoiCMzPuy23uWh2DnOzQYYGyYz0QwWvnXWNVq18hp
0+rGFYfW2md9lKQMWluCU73eA632KQkhj7hYFAr0EeDakRz0Lzz9ARY39LREd0cxv9elig6s
HguMlHwhfyPMMCmnhFQbaVyU9MQxnAe2Frk6wh/e7GFd5FsiAEfYilQkW3c0ChZFqIYv5kwn
lga9ww0CKaT3ndidSy85MH+FfP3f0/Qoz+fT5fqhAr+/Oup0YxQ1MZiknnOhSKQLWNxznN8z
tMA02eA/o6YS00NTo23W0M+5R984b/AJW4y/8TbzmYrNu7tiSXk4skYFesL+BaNWfAGPZu5S
AvwVuA/X/mgJrMrinWOQDw2O9186IlsEZK8RdC246jtHeJrkhaFj3tj2dFz/RGx8TFhQM7U2
pJQw+2ExhDVEHDjk0jnu8X+i4dCIz8IWWWnjiaiBJJUYvpZKNwkJT/zEuLo+PhAtbejeCt42
g6fPGI64uuZSCbcSgngxwsCz1gR83m8lnnil2Ytymtw8/LPgXaSnLToKUULYjcRHmVo0Qu8c
NfkhY5FV0PyMFQkn0O9vUvniZIOj/VHcFuJeGplIQmrYV03YuWN47qef9ZUpcgB/H95Hb6Sf
k+FDLf4qgkd1WXtBSYE6n1hWT6y98/XkAdhxTizKzspgiPiY+dJ3ibO5PLuRdN3+WMLfBQkj
TuSK33kDtenotSFurDtnNK5aky9ccV9IDPZ5rO7sm2a4WZkJT69gNSKy9PIXyhv9w2k+OlOb
BmW9zbQX7bA/PuGA7heUmRRJ2bHwplHHJpjmLc9lI1F2WQGno7Huj0Yjni1ONBSy6X4KnQXA
nkE25na+xOi3wo6FWiv/pnIR3Wz8MtMQf7jb1srhiY/qu1vUJaa4uNFjAZSjHSKqj//fd8ls
GYH+9Ae03hcouUCti4OzDq5O+EcMhpkOnnonhGC4sqi6b1/f2W+d7WskkBzzv67C7TX6ChZU
WT+fNEsB2U4usx5NlXR1nb+wojhccvXa5QdrEvHwF/7k+FJJcdoz6lCviFgI2+o5CJNI5MTk
0k3jtmz6ZKcIiB2/KvjX0ALfiSga8UIvS39kfUWlZOM0oSmDphtXS4KWYPsQKHNclMJ4O/jM
wiQSywhq3CbF6PfBgqY9B10r3HUAYqvaSrJLn4Enp1uERCYLV5YhkYaRmZygstgSFv7mZGxK
xkmtVVzh16thAFLz7BUMEvaX3zErQilLxYYGqOCJhhb5R0QwmbwHImg4/hoHiZerLamqhCAL
HDeWxVQADMlU1CJVDWBX7OusMjK9dOjJeGDLf6fQIy+qcJ/R9yiyZ6vidA9wieeacKtGHlAK
tYR3E1abXcsSKG7+j9aT2sazDOSUerGmCmy9QpQl4OW+fe7XgLO54ikBphSOMs24BmNqJq9N
OCRoGFGOS0Cx5cQm3rv5+c+2FsilC8+XVzPcK8nliXLV5L2n6x3Vj46LD9/ZOtM5L4T7DZcJ
M3C0di2369n0OUQJVBBU1z/qMKoWus6OGPtFHn6Q3q5aZqNdA3ywPiSA8KsRr1qluBSsx+wn
m+HNFXGMBSRyQHNDBufbOZriDuaDDVyiIWnbgpQXDurXJfncBq9KNhtkXgszKYpgm+fLWcHK
msUmzBl9vm86CpCic9yEGtb4igtNbydhi+D5u/EK5Ab9bNzCTghzroCpDwh0+4RpChIR/1wz
TGW5td1u1/ziK3H0CduBSkO5SxGnIWRoW1uPKzD/d9JXH/W+xRL5mKVRFBC/oM5WoCw5fgR/
5zJk6T+QN8j29fEpJNFQdPXOcSKLDwrPEmhAybaWTMIVzuGL3vYnQRGle2KsGWPp80zrJ7rh
ZwFR5dSUVUnEfVcBF42VMcaLsJPVyg/2aWekNZO4HO/qBfLQ8AP5MidD6vIWKi3eGvD0eYUb
UZXzeuhd94fPNGnix09OlMkw4/BQRWMUNsVunVsc0of+mYR21JPZ0MD5nK/WCun52IVHvOv2
Bczgxl5Z6Ij7mSk+E85c3zNoiZ4i0wtgZPljDSWJSb2N7u1VJpKBjDcvhB0a8unBR1wcRX3m
lF4cjrZAq1clKclLCZijQbOvp1UFOUaRqpBM1ccxvCSMu0hyk8U6j6myklO+fbfBNN8mRErf
5+hozMI2w9qYNMvY62FDKNMx0pXgOSApHzg2uU42gRLP08W6yvSYHsRpUUSP786JiyltuBt8
lmEnD1OOSAAAvMvq+Bt8AUzIYxs1grY3qRGB1qrMPbXb6aJ4jCZ09WLU1U9ygUCmhsN9rFw1
8A/O0GTTVoix6eVBnFrfYLDLx1YddJI+WSbZiuIvejXiZtoI4WwEPzpRu6Spe4VhEyjBgMgA
4UL6IwPBJ6pmE3fKM7mKvYCx3BPrEziIlOCEfJCdTqClT4VpMf5woU2lYhRKzcBAHlsZD2t7
+WfrQsrjfyfGdYuNypGGNFYbjRuHpTix3083TwIFjS83+MHxRLX6i+l/n2WFzrtadd/Iv2ZN
nYOQJm7/ysy96+uhBvZ6JLbciugbY4744WWtLtK+szbVKNeEOZx6x6GwYVSGyD6AjGfG4DqL
JOqNNUhZoTsUnunF3flqG4eZfbYEuaQHvK6qQvvWIBfvZLd1TUqJ8i7UD8EUUQVxalL9Odna
AsPboBuKxfusQMjMaeyCA6d28epRSCjM3EFB+kaxuK8abtNyiMqZeLv03osQKYxyOyv+FIMT
pUH3XS8jb6zIpNTWi/pFjlBah3C8GAij2Y7cL54ka8vhQnFul4GP3WXefx1PSZfp99mQwvVO
W9/bwhwD16aho7e7gP+1rUb7Sxb2d1T1KUAuXz69PczeRqUUbew4dXQo3N4NJ49oLx3PJClK
MbU/J/ZmzXeStHXvGjnGGbgT6ADw4IJfXoIHaMUxjEvZJMK4dMbs0Y7CptuduMfAvdzrbvwN
mZpBnYKlSIEEqja/2ApqNaV9Yvnpk2iWJ4lLRoPvY4Ei94UQSlwJC0Ewc3rH4nbjG6LTGEXL
RxbsFgKvl5Y0Nc2J7i5qIPTBIdB0TtXv+55XmPQG59k+kG6LwPeyVn0RfO9kvC4iAdbzfbiy
N4eC1Z0DUlQwfoTl1N9de0xcfVI+NaM62fUJiaY9Cr3xeCrJUdc05jRZwSgVczetnv6XzFa8
3BHIO0HgHzZC5kWlBJ0Lagxo1AZatr+IB+nvWV5n9Q0ReXnBcr2mFp99CxcSy32T4oQVLFs7
g3cU2c6P52g8I29NogXaTVzpLa3mn53oHhdaRyRw51BLcpA+XgFWTFdpjPbssH4G6ghkYdmS
oQBJNtyoSK3QvseYcHL+iBu6uG1liCJ8W1jvA/jnm+/EfPkH7MGr2dARQ4ifTvCp0J3F7Mh7
yL5qHORmXpF1slrO4jVv217pyt7FZ1VQD9M3GKiKRJ9VjMV1ocSYLSQeMtaTf4oYBapMBFrD
v8q0XuC+kRslGv4aSh/5UNKvjrQVA4uWWwJk6/gzHcA/9q/N2ZQGPcqJX0xKj3IIAWBlWVLs
QZDPgt0DosBDI8N+qlHj9IFr4yYFBvqcHBfGkQlbFhds7IXlFYf4hzJKGaEV1XuL62V9EUwJ
53Zrdb1fqmlul0b0sW/9rh/rvVLRmX6y1P8B4mA/smm7IHM7gzULMKae6W9eSOTFmOK10zhw
+18X9+SuHKLeAtDd8sgkjx+PMGnUzSXe0wBfvNTJlIHB/8kL48c+aYDOJEiIOFTocoPTlqGX
k+9RdDp9qUeaAiPA2yZdnTJ8/Tj89+Pq+aBEa6xOIrUgC+WC6NvYsUns3+rQfGzjtUYog2sg
JIPvgs/QFzCeUhttfzHIQUGrImnZhK659syHiLQDYs2mne/jkdHP9EaRSGn6twR1Y9Z5XDsS
Ol5zlmW0qUa9r9q7pMy6qxozsH8LLnbKPBTu0tqShaOAQAi+pIoCWl5D2dfB41ZYO/WZrgch
NvypvrfHvRSsUXJvfdcdcOCIFzd3MSiTy6RUgABxUEIrDcIKQ2H2uXDkKhxCKPH7aD41k8r/
1miP0sGwbRqts+P/quFovOSbgOEkORCAPSyAJu19+xw6CbwrbU+mbUDe3J4eViiALFFD4gGx
XbmwLxsxy9/dqGLV7/m5vNHUGo02zz6nJUoVQ9OQKpNR+PWpdQDxDtny+aEadFOK/oYlmzTS
U71Te8IlyGg4HHIfGRu2gmW3gy1ajmQsHTcnAZWcRb8leXLmE1IULK6HgFbWiO7Pkk+vinFb
2+K/JLn/L846k07KDmurNWWiG6oI69aBeX2fJnFeXVyv1cLlNg2W8Dp1J1eBtemPJJItnh7Z
+nZ7XimiGlKpKIN1O+8qomFv/7QG3enlaiTrb6AkStZxnYPtlY68tm8N/vK6rViptyh0m8DS
CE5tRGTAXZdS5TS9xVNYRDNy0LXgMkNI80f0GR9yUz9+K16Bts2/RdZEJ3NfLUJojWhYFMcL
n6VZM8xXSSFlTJSF0DyFx92AvplsF8=
IronPort-Data: A9a23:7Qw0taPHTVX/16jvrR19ksFynXyQoLVcMsEvi/4bfWQNrUok1GMPx
jRKC2CGMv+CYDH1KdsiOY7n/UoEu5LQyNY2GgBp+yAxRnsa98OYXo7AIh3+Z37NI8TNR0xp4
pgQN4LMcJlkH3TRjynxDrWw9nMUOYNk51bfILeaZX8uH1Y6IMsFoU878wLsqtcw2bBVOyvU5
ZWq5ZS31GaNg1aYCEpNg064gE4p7KSaVA8w5ARkPKkR5QKGzhH5MbpGTU2PByunKmVrNrPiL
wrz5OnRErTxpkpF5nuNy94XQ2VSKlLgFVHmZkl+AcBOtiN/Shkajs7XAtJFNxgI1G/Qwbid/
/0W3XC4YV9B0qQhA43xWTEAe811FfQuFLMqvRFTGCFcpqHLWyKE/hlgMK05FbZJ9Pw0X1tMz
vE7JRwPNQ6J3qGO4q3uH4GAhux7RCXqFIpH/yg4kXfCCOo+BJfeX+PH+JpH0Swsw5kIFPPXd
c0fcjd0Kh/HZnWjOH9KVNRkwL/u3j+mK2EwRFG9/cLb50CJlFYoieK0bYKFJ4bWGpVfwxmU/
jucpWjzXk1KZYPPw2Ta+Xn22bPClnvjAI8PUZbi1aJBqmy66FwuOEckfVG8vP+yh1X4UtdWO
UsSvCQ0xUQ33BP3EoejA0fj/hZouDYVaYYPOO4L9ziPifT0pBqdV1MrXmNePYlOWMgeHmJxj
wbhc8nSLThmtbeYU27Y7p+PriK0NDRTJ2JqWMMfZQJdpoC7/Mcoiw7XC9F+DOi4k5jqFCrsh
mnMpS03lbIVlsMQka68+Dgrng5AuLDyHwAvpVvtXFmozQ5VZtW7bdXr0XrEuKMowJmicnGNu
30Nms675e8IDI2QmCHlfAnrNOH3jxpiGG2C6WODD6XN5Bz2pCH+JdE4DCVWYRY2YpxdKFcFd
WeK4VsJjKK/KkdGekOeXm5cI81yiPG4SZL+U+zMK91Tft58aUqY8TpyIBfW1mXkgk8qiqwkf
5ycdK5A7Er264w5k1JapM9HiNfHIxzSI0uPG/gXKDz7jNKjiIa9E+ttDbd3RrlRAFm4iAvU6
c1DEMCB1g9SVubzCgGOr9VCcQpSdyBjXsCswyCySgJlClo2cI3GI6+BqY7Nh6Q8x/89ehrgo
yzkAxcGlwCXaYPvclXWMyA9AF8QYXqPhSllZnV1VbpZ83EmaJSo6uEUcJ5fQFXU3L0L8BKAd
NFcI5/oKq0WElzvpmpBBbGg8t0KXEn71GqmYnv+CBBiLs4Ib1KTprfMIFC1nAFQVXXfiCfLi
+b9vu8tacFfHFsK4Qe/QK7H8m5dSlBBwr8vBBWRfYEIEKgumaAzQxHMYjYMC5hkAT3KwzKI0
ADQDw1wmAUHi9ZdHADhif/WooG3PfF5G0YGTWDX4azpZHuApjD6mNUZDb7YIGqBCzP+pfquP
bwPlf32bKFXzQkaudQjGL0xkv4z7IP3/7JHiy8+PyngRWWCJINdEiO09cNIq6tGy6QfsA6/S
EWJvNdAYO3bNMTgGV8XBQwkcuXaj6lEwWKNtK9tLRWo/jJz8ZqGTV5WY0uGhhtbIeYnK4gi2
+og5JMb5lXn2BonO9qLlA5O8GGIIiBSWqkrrMhKUobtjA02zFpPSZXZAz3x5teBcYwUYEUtJ
zaVgovEhqhdnxCaIyFoSiGWhecE3MYAohFHylMGNm+loNudi69lxgBV/BQ2Uh9RkkdN3dV1N
zU5LEZyP6iPo2plicUfDWChHwZNWE+Q9kDrkApbnTWcFhH0EHfIMHV4PvuRuk0Etn1RZSQep
feRzW/3VjDxcdq31Sw3ABY3p/vmRN131wvDhMH+RZvYQchnPmO9j//8f3cMpjvmHdg12x/Kq
Oxsy+B6Nv/2OCsWlKskBtTIzr8XUh2FeDdPTK0z5q8PBm2AKji+1SLVehK4IoYUf6CM6kqkE
4lpO94JWgn7yyuVsnVCQ6cJKq1zmuUk/5wJfbayfTwKtL6WrzxItpPM93Gk2zJ1EogxyJ4we
tHLajaPMm2Mnn8LyWLAqc9zPGDnM9QJYQvL2v+4rbcSHJUZveAwKkw/39NYZZlO3NeLIv5Vg
O/CW0MS5+U6jN00w833F7lbQgKpNZX+SaGX/Ruv9o0IZNbGI8DIrA4O7FLgOmy6+FfXt8tfz
dywXBzfhSspf4ral0jTnISHHKRSo8y3VfhQNIT5NhG2WAOcDdT07UJrF3+QcPR0fRA02iVjb
wK9Ydm3c5gbQb+xAVVOcyYEVU5157vfMM/dmM92kxhA5tXxH+AKwBNLOEIFtV1mSxI=
IronPort-HdrOrdr: A9a23:rPqBRKHjIqq5Oa47pLqE1ceALOsnbusQ8zAXP3gbc202TiX4ra
CTdZEgvnXJYVkqKRYdcK+7Sc+9qB/nmKKdgrNxAV7BZmbbUQKTRelfBODZrQEIdReTygZ7vp
0QEJSXM7bLfD1HZf+Q2njdLz8o+qj/zJyV
X-IronPort-Anti-Spam-Filtered: true
X-Proximus-Type: blk
X-MGA-submission: =?us-ascii?q?MDEqza4iE8YPxWHWZvtGI2ucPfrhnCfNOWXz5i?=
=?us-ascii?q?mWb2IfMlQJg2x59sor1lXeDzqnkY9q9I7MS/zCIRR1rU5+c4/RtoqWb5?=
=?us-ascii?q?klksU8ttYfbwgi/rv3D0eYXetW3wCq8L+3fBc=3D?=
Received: from a0-104.smtp-out.eu-west-1.amazonses.com ([54.240.0.104])
by mx101.skynet.be with ESMTP; Mon, 27 Jun 2022 01:24:17 -0400 (EDT)
DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple;
s=sllfv3yuiohfqhsmot2zhkszrl636bou; d=amazon.fr; t=1639558367;
h=From:To:Message-ID:Subject:MIME-Version:Content-Type:Date;
bh=Y2a0JpRSZoBMxYR9CdhvN3tmWCR833Z45mzfgmG0mP7=;
b=l/e3y7VL5TVfgOOQ+Aak8nhIjkCeKhav1saSAUVkfiL/Wxs2ylt6mOG7IlmXwf8B
sOKcnsXNmkH1HI/td8HlctGZWyukq3c+ayw6sMFolnhvZkiWOXsj8HBU/TZ5Fc9XQkQ
xghRrmnljhO1tOrMfHz6PL3cX5oOlriXADXlrttU=
DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple;
s=uku4taia5b5tsbglxyj6zym32efj7xqv; d=amazonses.com; t=1639558367;
h=From:To:Message-ID:Subject:MIME-Version:Content-Type:Date:Feedback-ID;
bh=Y2a0JpRSZoBMxYR9CdhvN3tmWCR833Z45mzfgmG0mP7=;
b=O7OvyG1IVr5xzB2OUm7EVlAs2/54SNmaY2n623K2zbKRkOu/zQ98Nzi43T8AbpeC
TUn9Slr4jJBKoEipYdWzd+1P/KyofmO6gU9A9WPWvNCbhECw874UIR3krloMdJczzU3
Be74sNi85evCFtyUZcDXMQRHhkAlZtLrkrPpUWXU=
From: "=?UTF-8?B?bXNsaWRsLm5vdGlmaWNhdGlvbg==?="
To: antzbob@orange.fr
Message-ID: <47ip6vbxqt-f3hmeay5-1ul4-1ul4-1ul4-0eh8gcvto7kw-000000@eu-west-1.amazonses.com>
Subject: =?UTF-8?B?dW5lIGxsc3VycHJpc2VsbCBhIHZvdXM=?=
MIME-Version: 1.0
Content-Type: multipart/related;
boundary="----=_Part_1315770_891340126.1616412861426";
type="multipart/alternative"
X-AMAZON-MAIL-RELAY-TYPE: notification
Bounces-to: sng9ulbd0wsgi9zke96fge5nunan0xx5rq213ky0aq8ui5-8YG4F9ATFGACTO@bounces.amazon.fr
X-AMAZON-METADATA: CA=8YG4F9ATFGACTO-CU=8YG4F9ATFGACTO
X-Original-MessageID:
Date: Mon, 27 Jun 2022 01:24:17 -0400 (EDT)
Feedback-ID: 1.eu-west-1.VnPs1HGfBt+bhJpFXTOqf9xeCZmOmOpADlGnFbaAkK2=:AmazonSES
X-SES-Outgoing: 2021.12.15-54.240.0.104
X-VadeSecure-Score: 17
X-VadeSecure-Verdict: commercial:mce
X-VadeSecure-Cause: gggruggvucftvghtrhhoucdtuddrgedvuddrledugdduudekucetufdote
ggodetrfdotffvucfrrhhofhhilhgvmecurfftqfgikffofgfunecuuegrihhlohhuthemuceftdd
tnecundfotefknffkpffiucdludejmdenucfjughrpefhvffkufggtgffsegrtdersgdttdejnecu
hfhrohhmpedftehmrgiiohhnrdhfrhdfuceorghnnhhouhhntggvsegrmhgriihonhdrfhhrqeenu
cggtffrrghtthgvrhhnpedttdegffehvddvgeekvdehteetveetheetgfekhfdvteeiueekffevke
dugfevieenucffohhmrghinheprghmrgiiohhnrdhfrhdprggsohhuthgrmhgriihonhdrfhhrpdh
frggtvggsohhokhdrtghomhenucfkphepheegrddvgedtrddtrddutdegnecuvehluhhsthgvrhfu
ihiivgepfeenucfrrghrrghmpehinhgvthepheegrddvgedtrddtrddutdegpdhmrghilhhfrhhom
hepvddtvdduuddvudehtdekhedvgeejkegsheejugdtuddvvdgusgeggeekleejkegsieejtggtvd
ejgegvtgdtphdtvghuqdevvdfmgeevuegjtefhiggfigdvkgessghouhhntggvshdrrghmrgiiohh
nrdhfrhdprhgtphhtthhopehlrghmsggvrhhtqdhpsehskhihnhgvthdrsggvpdhmohguvgepshhm
thhp

Pièce(s) jointe(s)
Pour en Savoir +
Alertez vos Amis !
Victime d'une arnaque ? Faites-vous aider

  • Les avis et commentaires laissés par les internautes sont classés par ordre chronologique et ne sont pas contrôlés à priori. En savoir +

    • Fraud Watcher/Advisor le 03/07/2022 à 14:38

      À propos de cette adresse IP address : 103.79.16.7 qui confirme l’origine de sa provenance via un datacenter (centre de données) d’un fournisseur d’accès internet - FAI basé à Karachi au Pakistan.

      Pour les problèmes de piratage informatique, d'abus frauduleux, de spam ou de sécurité, veuillez signaler et transférez nous cet email en l'état grâce au bouton "transfert" de votre messagerie à cette adresse mail suivante :

      ipadmin@sharpcommunications.pk

      Information related to 103.79.16.0 - 103.79.19.255

      Abuse contact for 103.79.16.0 - 103.79.19.255 is ipadmin@sharpcommunications.pk

      inetnum: 103.79.16.0 - 103.79.19.255
      netname: SHARPCOM-PK
      Sharp Communications (Pvt.) Ltd
      country: PK (Pakistan)
      org: ORG-SCL6-AP
      admin-c: SCPL4-AP
      tech-c: SCPL4-AP... Lire la suite

      Répondre
    • Fraud Watcher/Advisor le 03/07/2022 à 14:43

      À propos de cette adresse IP address : 10.217.70.16 qui confirme l’origine de sa provenance via une société américaine privée Internet Assigned Numbers Authority qui supervise l'allocation globale des adresses IP très prisée par les escrocs, les fraudeurs, les arnaqueurs, les scamme(u)rs, les harke(u)rs, les brouteurs, les spamme(u)rs, etc… pour « leur business / activité malveillant(e) » qui ne veulent pas laisser de traçabilité de géolocalisation de leur propre adresse IP privée histoire de brouiller leur domiciliation légitime.

      Pour les problèmes de piratage informatique, d'abus frauduleux, de spam ou de sécurité, veuillez signaler et transférez nous cet email en l'état grâce au bouton "transfert" de votre messagerie à cette adresse mail suivante :... Lire la suite

      Répondre
    • Fraud Watcher/Advisor le 03/07/2022 à 15:08

      À propos de cette adresse IP address : 40.92.91.28 qui confirme l’origine de sa provenance via un datacenter (centre de données) d’un serveur de Microsoft Corporation basé à Redmond dans l’état de Washington (USA).

      Pour signaler des problèmes de sécurité suspectés spécifiques au trafic émanant des services en ligne Microsoft, y compris la distribution de contenu malveillant ou d'autres éléments illicites ou illégaux via un service en ligne Microsoft, veuillez soumettre vos rapports à :

      https://cert.microsoft.com

      Pour les SPAM et autres problèmes d'abus, tels que les comptes Microsoft, veuillez contacter :

      abuse@microsoft.com

      Pour signaler des failles de sécurité dans les produits et services Microsoft, veuillez contacter :... Lire la suite

      Répondre
    • Fraud Watcher/Advisor le 03/07/2022 à 16:18

      À propos de cette adresse IP address: 54.240.0.104 qui confirme l’origine de sa provenance via un datacenter (centre de données) d’ Amazon Technologies Inc. basé à Seattle, dans l’Etat de Washington (USA).

      Signaler un abus AWS (Amazon Web Services) :

      Veuillez envoyer les rapports d’abus présumés d’Amazon Web Services à :

      abuse@amazonaws.com

      email-abuse@amazon.com

      Tous les rapports d'abus DOIVENT inclure:

      * src IP
      * dest IP (votre IP)
      * dest port
      * Date / horodatage et fuseau horaire précis de l'activité
      * Intensité / fréquence (extraits courts du journal)
      * Vos coordonnées (téléphone et email)

      Sans ces informations, nous ne pourrons pas identifier le bon propriétaire de l'adresse IP à ce moment-là.

      Et veillez à inclure autant de détails que possible. Veuillez noter que nous n'ouvrirons les pièces jointes sous aucun prétexte.... Lire la suite

      Répondre
    • Fraud Watcher/Advisor le 03/07/2022 à 17:18

      À propos de cette adresse IP address: 52.82.172.0 qui confirme l’origine de sa provenance via un datacenter (centre de données) d’un opérateur et fournisseur des services cloud basé à Pékin en Chine.

      Pour les problèmes de piratage informatique, d'abus frauduleux, de spam ou de sécurité, veuillez signaler et transférez nous cet email en l'état grâce au bouton "transfert" de votre messagerie à cette adresse mail suivante :

      ipas@cnnic.cn

      Information related to 52.82.0.0 - 52.83.255.255

      Abuse contact for 52.82.0.0 - 52.83.255.255 is ipas@cnnic.cn

      inetnum: 52.82.0.0 - 52.83.255.255
      netname: WESTCLOUDDATA

      Au sujet de...

      Ningxia Western Cloud Data Technology Co. Ltd. (NWCD en abrégé) est l'opérateur et le fournisseur des services cloud de la région Amazon Web Services China (Ningxia). Amazon Web Services est le partenaire technique stratégique de NWCD et fournit à NWCD la technologie, les conseils et connaissances professionnelles.... Lire la suite

      Répondre

    Votre commentaire sera mis en ligne
    immédiatement après votre validation

  • Groupe créé le - 0 Membres

    Pour visualiser le contenu de ce groupe privé ou demander à le rejoindre, vous devez créer un compte ou vous connecter .